KEGG   Dickeya zeae EC1: W909_09515Help
Entry
W909_09515        CDS       T03567                                 

Definition
(GenBank) anthranilate synthase subunit I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
dzc  Dickeya zeae EC1
Pathway
dzc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dzc01100  Metabolic pathways
dzc01110  Biosynthesis of secondary metabolites
dzc01130  Biosynthesis of antibiotics
dzc01230  Biosynthesis of amino acids
dzc02024  Quorum sensing
Module
dzc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dzc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    W909_09515
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    W909_09515
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    W909_09515
Enzymes [BR:dzc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     W909_09515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N RT_RNaseH_2
Motif
Other DBs
NCBI-ProteinID: AJC66285
UniProt: A0A0A8FH23
LinkDB All DBs
Position
complement(2094007..2095569)
Genome map
AA seq 520 aa AA seqDB search
MHTPQPELELLRVDAEYRNDPSATFHQLCGARPATLLLESAEIDSKQNLQSLLIVDSALR
ITALGSQVSIQALTANGASLLPLLDKALPSDVTVDVRPNGRELTFPGIDGLLDEDARLRS
LSVFDALRQMLTLVTCPPDEREAMFFGGLFAYDLVAGFESLPPLSQQQRCPDYCFYLAET
LLIVDHQKRVTHLQASLFTPDATERLRLQQRLEQLQHQLRQPAPALPYQTVDTMTLNCNQ
SDEDYGAVVSQMQQAIRIGEIFQVVPSRRFSLPCPSPLAAYQTLKDNNPSPYMFYMQDQD
FTLFGASPESSLKYDAISRQIEIYPIAGTRPRGRRADGSLDRDLDSRIELEMRTDHKELA
EHLMLVDLARNDLARICEPGSRYVADLTKVDRYSFVMHLVSRVVGTLRHDLDVLHAYRAC
MNMGTLSGAPKVRAMQLIAESEKTRRGSYGGAVGYFTARGDLDTCIVIRSAYVEDGIATV
QAGAGVVLDSQPQAEADETRNKARAVLRAIASAHHAREVF
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcacacaccacaacctgaactagagctgttgcgcgtcgacgccgaataccgtaacgat
cccagcgccacgttccatcaattatgcggcgcgcgtccggcaacgctgttgctggagtca
gccgagatcgatagcaagcagaatctgcagagcttgctgattgtcgacagtgcattgcgt
attaccgccctcggctcgcaggtatccattcaggcattaacagctaacggtgcctcgctg
ttaccgttgctggacaaggcactaccgagcgatgtcacggtcgatgtgcgtccaaacggt
cgcgaactgacctttcctggcatcgacggcctgttagatgaagatgcgcgcctgcgctcg
ctgtcggtattcgatgcgctacgccagatgctgacactggtgacctgcccgccagacgaa
cgtgaagcgatgttcttcggtggcctgttcgcctacgatctggtagccggcttcgagagc
ctgccgccactcagccagcaacagcgctgcccggattactgtttttatctggctgaaaca
ctgctgattgtggatcaccaaaaacgggtcacccacctgcaagccagcctgtttacacct
gatgctactgagcgtctgcgtctgcaacagcgtctggagcagttacaacaccagttacgc
cagcctgcgccagcgttgccgtaccagacagtagacaccatgaccctgaactgcaatcaa
agcgatgaagactatggtgccgtcgtcagccagatgcagcaggcaatccgcatcggtgag
atcttccaggtcgtcccatcccgtcgtttctcgctgccatgcccgtcaccgttggccgcc
taccagacactgaaagacaacaatccgagcccttacatgttttacatgcaagatcaggat
ttcaccctgttcggtgcctcgccggaaagctcgctcaaatatgacgccatcagccgccag
attgaaatctaccctattgcaggcactcgtcctcgtgggcgtcgcgctgacggctcgctg
gaccgggatctggacagccgtatcgaactggaaatgcgcaccgaccataaagaactggcc
gagcatctgatgctggttgacctagctcgcaacgatttggcgcggatctgcgaacccggt
agccgctatgtggctgacctgaccaaagtggaccgctactcattcgtgatgcatctggtt
tctcgggtggttggcacgctgcgtcacgatctggatgtcctgcacgcctaccgcgcatgt
atgaacatggggacgctcagcggcgcgcctaaagtccgggcgatgcagttgatcgcggaa
agtgagaaaacacgccgcggcagctacggcggtgcggtaggttacttcaccgcacgtggc
gacctcgatacctgcatcgtcatccgttccgcctatgtggaagatggcatcgctaccgtg
caggctggtgctggcgtcgtgctggattcccagccgcaagccgaagccgacgagacccgt
aacaaagcccgcgcggttctgcgcgcgattgccagcgcgcatcatgcccgggaggtgttc
tga

DBGET integrated database retrieval system