KEGG   Dickeya zeae EC1: W909_09895Help
Entry
W909_09895        CDS       T03567                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dzc  Dickeya zeae EC1
Brite
Enzymes [BR:dzc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     W909_09895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AJC66359
UniProt: A0A0A8FC19
LinkDB All DBs
Position
2186939..2187463
Genome map
AA seq 174 aa AA seqDB search
MKLNALILSGLFISAITHAASTTVTLKEALPTGDGDTLGNITITETEYGLLFSPNLKGLQ
PGIHGFHVHANASCAPGVQNGNTVPALAAGGHLDPQKTGRHLGPYNDKGHLGDLPGLVVN
ADGTATYEVLAPRLKSLSEVKDHALMVHTGGDNYADTPKELGGGGIRIACGIIQ
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcaacgcactgattctgtctggcctgttcatcagcgccatcacccacgcggcc
agtacgaccgtcacgctaaaagaagcactgcccactggcgatggcgatacgcttggtaat
atcaccatcacagaaacagagtatggcctgctgtttagtcccaacctgaaagggttgcag
cctggcattcacggtttccacgtccatgctaatgccagttgcgcgccgggcgtacaaaat
ggcaataccgtaccggcactggcagcgggcgggcatctggacccgcaaaaaaccggtcgg
catctcggcccttacaatgataaagggcatttgggcgatttacctggtctggtcgtcaac
gcggatggcaccgcgacttatgaagtactggcaccacggttaaaatcgctatcagaagtg
aaggaccacgccttgatggttcataccggtggtgacaactacgccgacacgccgaaggaa
cttggcggcggtggaatacgcatcgcctgcggcattatccagtga

DBGET integrated database retrieval system