KEGG   Dickeya zeae EC1: W909_13690Help
Entry
W909_13690        CDS       T03567                                 

Gene name
fadJ
Definition
(GenBank) fatty-acid oxidation protein subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
dzc  Dickeya zeae EC1
Pathway
dzc00071  Fatty acid degradation
dzc00280  Valine, leucine and isoleucine degradation
dzc00281  Geraniol degradation
dzc00310  Lysine degradation
dzc00362  Benzoate degradation
dzc00380  Tryptophan metabolism
dzc00410  beta-Alanine metabolism
dzc00640  Propanoate metabolism
dzc00650  Butanoate metabolism
dzc00903  Limonene and pinene degradation
dzc00930  Caprolactam degradation
dzc01100  Metabolic pathways
dzc01110  Biosynthesis of secondary metabolites
dzc01120  Microbial metabolism in diverse environments
dzc01130  Biosynthesis of antibiotics
dzc01200  Carbon metabolism
dzc01212  Fatty acid metabolism
Module
dzc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dzc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    W909_13690 (fadJ)
   00650 Butanoate metabolism
    W909_13690 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    W909_13690 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    W909_13690 (fadJ)
   00310 Lysine degradation
    W909_13690 (fadJ)
   00380 Tryptophan metabolism
    W909_13690 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    W909_13690 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    W909_13690 (fadJ)
   00281 Geraniol degradation
    W909_13690 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    W909_13690 (fadJ)
   00930 Caprolactam degradation
    W909_13690 (fadJ)
Enzymes [BR:dzc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     W909_13690 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     W909_13690 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     W909_13690 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AJC67071
UniProt: A0A0A8FFB6
LinkDB All DBs
Position
complement(3000219..3002411)
Genome map
AA seq 730 aa AA seqDB search
MTEQLGMDQTDERGTQAAFQLTFRPDHIGVITVDVPGEKVNTLKAEFAEQMQTVLSQARQ
YNGLQGLIILSGKPASFIAGADIGMLDACADVASAQKLAETGQHALDAIAHLPFPVVAAI
HGTCLGGGLELALACDYRLCTADDSTRLGLPEVQLGLLPGAGGTQRLPRLIGVDRALELI
LTGRQLRAAQARRIGLVDEVVAPAVLLEAALGFIRRGKRPVTSPGWRHRLLMLPYVRRWL
FERVRRQTLAKTQGNYPAATRIIEVVRRGLEQGSQVGYQGEARAFGQLVVSPESVALRRL
FFTTTALKKDFGAPVAPGPLRRVGVLGGGLMGGGIASVTALNGQLPVRIKDIQEQGITQA
LHSSWQRLSKQVARRRITPAEQRRQMSLLSGGTDYRGFEHVDVVVEAVFEDIALKQQMVR
DIEAVTPPHTVFATNTSSLPIHQIAAGASRPEQVIGLHYFSPVDKMPLVEVIPHAGTDNS
TLATTVALARKQGKTAIVVADKAGFYVNRILAPYLNEAARCLLEGEPVESIDRALVRFGF
PVGPFTLLDEVGIDVAMKIVPVLVTELGERFCAPAALEAIARDNRKGRKNGRGFYRYDLS
RYERLCNWWRRQHKVSDSRIYRLLDVTPTAHLDPALMTQRCVMMMLNEAVRCLDEGVIRR
PGEGDIGAVMGIGFPPFLGGPFHYMNQLGITTVVGTLRSLQKQYGDRFAPAEGLLRRQSE
QTGFIDDTMS
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgacggagcagttagggatggaccaaacggatgagcgcggcacccaagccgctttccaa
ctgacatttcgccctgaccacatcggggtgattaccgtggatgtccccggtgaaaaagtg
aacaccctgaaagcggaatttgctgagcagatgcaaaccgtgttgtcacaagcccggcag
tacaacggcctgcaggggctgattatcctgtcaggaaaaccggcgtcgtttattgcgggg
gcggatatcggcatgttggatgcctgtgccgatgtggccagtgcgcagaagctggccgaa
accggccagcacgcgctggatgcgatcgcccatctgccgttcccggtggtggcggctatt
cacggtacctgtctgggtggtggtctggaactggcgctggcgtgcgactatcggctctgt
accgccgatgacagcacccgcctcggattaccggaggtgcaactggggctattaccggga
gcggggggtacccaacgtcttccacgtctgataggcgtggatcgtgcgctggagttaata
ctcaccgggcgacaactgcgcgctgcgcaggcacggcgtatcgggctggttgatgaggtg
gtggcccccgccgtcttgctggaggcggcgctgggttttattcgccggggtaaacgtccg
gtgacctcacctggctggcgacaccggttactgatgctgccgtatgttcgccgttggctg
tttgagcgggtgcggcgacagacgctggcaaaaacgcagggcaactatccggcggcgacg
cgcatcattgaggtggtgcgccgtggtctggagcaggggagtcaggtggggtatcagggc
gaggcccgcgcgttcgggcaactggtggtgtcgccggagtccgtggcattgcggcggttg
ttttttaccaccacggcattgaaaaaagattttggtgcgccggtggctcccggcccatta
cgtcgtgtcggcgtgctgggtggtgggttaatggggggcggtatcgccagtgtgacggca
ctgaacggccagttaccggtaaggattaaggatattcaagagcaggggatcacccaggca
ttacacagtagctggcaacggctaagcaagcaggtggcccgtcggcgtataacaccggca
gaacagcggcgacagatgagcctgctctccggtggcaccgattatcgagggtttgagcat
gttgatgtggtggtggaagcggtatttgaggatatcgcgctcaaacagcagatggtgcgg
gacatcgaggcggtcacgccaccccataccgtgtttgctaccaacacgtcatcgttaccc
atccatcagattgccgcgggggccagccgtccagagcaggtgatcggcctgcactacttt
agcccggtggataagatgccgctggttgaggttatccctcatgccggaaccgataactcg
acgctagccaccacagtggcgttggcgagaaagcagggcaaaacggcgattgttgtggcg
gataaagccgggttttacgtcaatcgtattctggcaccttacctgaatgaagcggcccgc
tgcctgctggaaggggaaccggtcgagtcgattgaccgggcgctggtccgttttggtttt
cctgtcggcccgtttaccttgctggatgaagtggggattgatgtggcgatgaaaattgtg
cccgtgctggtcaccgaactgggagagcgattctgcgcgcctgcggcactggaggcgata
gccagagataaccgcaaagggcgtaagaacggacggggtttttatcgctacgatctgtct
cgctatgagcggttgtgcaactggtggcgtcggcagcataaagtctctgatagccgtatc
tatcgcttgctggatgttacgccaaccgcgcatctggacccggcgttgatgacgcagcgc
tgcgtcatgatgatgcttaatgaagcggtacgctgtctggatgaaggggtgattcgtcgc
ccaggggagggggacatcggcgcagtcatgggcattgggttcccaccgttcctgggggga
ccatttcattatatgaatcaattgggtatcacgacagtggtcggtacgctgcggtcattg
caaaagcagtacggcgatcggtttgcccctgctgaagggctgctccggcggcagtctgaa
cagaccggttttatcgatgacacgatgagttaa

DBGET integrated database retrieval system