KEGG   Dickeya zeae EC1: W909_18665Help
Entry
W909_18665        CDS       T03567                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dzc  Dickeya zeae EC1
Pathway
dzc00564  Glycerophospholipid metabolism
dzc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dzc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    W909_18665 (glpD)
Enzymes [BR:dzc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     W909_18665 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_oxidored Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: AJC67992
UniProt: A0A0A8FHS4
LinkDB All DBs
Position
4147141..4148640
Genome map
AA seq 499 aa AA seqDB search
METQDLIVIGGGINGTGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVGEALSEREVLLKMAPHIIFPMRFRLPHQPHLRPAWMIRAGLFMYDHLGKRVSLPSS
HGLRFGRESVLKPELTRGFEYSDCWVDDARLVVLNAQEVVRRGGEVKTRMKVTRAHRENG
LWIVEAEDALSGETHRWQAKGLVNATGPWVRQFFDDGLALPSPYGIRLIKGSHIVVPRVH
QEEQAYILQNKDHRIVFVIPWQDEFSIIGTTDVEYHGDPHQVKIDDNEIRYLLDVYNDHF
KKQLTRDDIVWTYSGVRPLCDDESDSPQAITRDYTLSVADENGKAPLLSVFGGKLTTYRK
LAEHALEKLVKYYPQAGQAWTRNAILPGGDISGSREDYAATLRRRYNLPEALARRYSRTY
GSQSEKILGNAQSLSDLGEHFGHNLYEAELRYLVEHEWVVTLEDAIWRRTKLGMWLDDAQ
RQRVADWLVSYRSQLAKAG
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
gtggaaacccaagatctgatcgtgatcggcggaggcattaacggcacgggcatcgcagca
gatgccgccgggcgcgggctgtccgtcctgctgctcgaagcgcaggatctggcctgtgcg
acctcttccgccagttccaagctgattcacggcggcctgcgctatctggagcactatgag
ttccggctggtgggggaagcgttgtccgaacgcgaagtgttgctgaaaatggcaccgcac
atcattttcccgatgcgttttcgcctgccgcaccagccgcatttgcgcccagcctggatg
atccgcgccggtctgttcatgtatgaccatctgggcaaacgtgtcagcctgccgtccagc
cacgggctgcgattcggccgtgaatcggtgttaaaacccgagctgacgcgcggtttcgaa
tattccgattgctgggtggacgatgcccgtctggtggtgctgaacgcgcaggaagtggtg
cgccgtggcggcgaggtgaaaacccgcatgaaagtcacccgcgctcatcgcgaaaacggc
ctgtggatcgtcgaagccgaagatgccctcagtggtgaaacccaccgctggcaggcgaaa
ggcctggttaacgcaaccggcccgtgggtacgccagttcttcgatgacggtctggcgctg
ccatcaccgtatggcattcgtttgattaaaggcagtcatatcgttgtgccgcgcgtccat
caggaagagcaggcctacattctacaaaataaagaccaccgtattgtgtttgtgattccg
tggcaggatgaattctccatcatcggcaccaccgatgtggaataccacggcgatccgcat
caggtgaagatcgatgacaacgaaattcgttacctgctggatgtgtataacgaccatttc
aaaaagcagctgacacgtgacgatatcgtctggacgtattcgggtgtacgcccgttgtgc
gacgacgaatccgattcgccgcaggctatcacccgcgactacaccttgtcggttgccgat
gaaaacggtaaggcaccgctgctgtccgtattcggcggcaagctgaccacctaccgtaag
ttagcggaacacgcactggaaaagctggtgaaatactacccgcaagccggacaagcgtgg
acccgtaacgccattctgcccggtggtgatatcagcggcagccgcgaagattacgccgcg
acattgcgccgccgttacaatctgccggaagcgctggcacgtcgttacagccgcacttac
ggtagccagagcgagaaaatcctcggcaacgcccaatccttaagcgacctgggcgaacat
ttcggccataacctgtacgaagccgagttacgttatctggtagagcatgagtgggttgtc
acgctggaagacgctatctggcgtcgtaccaagctcggcatgtggctggacgacgcacaa
cgccagcgtgtcgccgactggctggtcagctaccgcagccaattagccaaagcgggttaa

DBGET integrated database retrieval system