KEGG   Dickeya chrysanthemi: Dd1591_1036Help
Entry
Dd1591_1036       CDS       T00930                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
dze  Dickeya chrysanthemi
Pathway
dze00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dze00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Dd1591_1036
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dze01003]
    Dd1591_1036
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dze01011]
    Dd1591_1036
Enzymes [BR:dze01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Dd1591_1036
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Dd1591_1036
Glycosyltransferases [BR:dze01003]
 Polysaccharide
  Bacterial polysaccharide
   Dd1591_1036
Peptidoglycan biosynthesis and degradation proteins [BR:dze01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Dd1591_1036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H PBP1_TM Transpeptidase UvrB_inter
Motif
Other DBs
NCBI-ProteinID: ACT05908
UniProt: C6CNI7
LinkDB All DBs
Position
1191860..1194361
Genome map
AA seq 833 aa AA seqDB search
MSRDDREPIGRKRSASRHTPPRRQATRRRRDDDYDDDYEDEYENDYDDDEDDEEEVMSKR
PRKKRRWLGWLIRLFLIFVVVMSVYGIYLDGEIRSRIDGKVWQLPAAVYGRMVNLEPGMA
YSKKEMANLLEGMQYREVSRITRPGEFTVQANNIEILRRPFDFPDGKEGQIHAKMIFSND
RLSQIQNMDNQRNFGFFRLDPKLITMLQSPNGEQRLFVQRSGFPDLLVQTLIATEDRHFY
EHDGISFYSIGRALVANLTAGRAVQGGSTLTQQLVKNLFLTNERSLWRKANEAYMALIMD
YRYSKDRILELYLNEVYLGQSGNDQIRGFPLASLYYFGRPVNELSLDQQAMLVGMVKGAS
LYNPWRNPQVTLERRNLVLKLLQNQQVIDEDLYNMLSARPLGVQPKGGAISPQPAFMQMV
RQELQQRLGDKANDLSGVKIFTTLDPVSQDAAEKAVEDGIPALRAARGVKDLESAMVIVD
RFSGEIRAMVGGSDAQFAGFNRAMQARRSVGSLAKPPTYLTALSMPDRYRLNTILVDEPI
SLKQPNGTVWEPKNYDREFRGRVMLVDALANSLNVPTVNLGMAVGLDQVSDTLQKLGIPQ
NQIQAVPAMLLGAVSLTPMEVAQEYQTIASGGSRATLSALRSVIAEDGKVLYQSFPQAER
AVPSQAAYLTLYGMQQVVERGTSRSLTVKFGNYHLAGKTGTTNDLRDSWFAGVDGKEVVI
TWVGRDNNGPAKLTGANGALTIYRRYLENQTPLPLVLTPPEGITTMSVDGSGNVICNGSA
GRALPVWSDNPQALCQASQQAVQQPTNSPNGQPQQNQQEGGSVPDWIKQMFGQ
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgggatgaccgcgaacctatcgggcgcaaacgtagtgcgtcacgacacactccc
cctcgcaggcaagcgacgcgccgtcgcagggatgatgactacgacgacgattatgaagac
gagtacgaaaacgactatgacgacgatgaggatgacgaggaagaggtcatgagcaagcgg
ccgcgtaaaaagcgccgctggctggggtggcttatccggctgttcctgatttttgtggtg
gtgatgtcggtttacggcatttacctcgacggagaaatccgcagtcgcatcgacggtaaa
gtatggcagttgccggcggcggtgtatggccgcatggtcaacctcgaaccgggtatggcc
tacagcaaaaaagagatggctaacctgctggaagggatgcaataccgtgaagtcagccgt
attacgcggccgggcgaatttacggtgcaagccaacaacattgaaattctgcgccgtcct
tttgatttccccgacggcaaggaaggccagatccacgccaagatgatcttcagtaacgac
cggttgtcgcagatccagaacatggacaatcagcgcaacttcggcttcttccggctcgat
ccgaaactgatcactatgttgcagtcaccgaacggcgagcagcggctatttgtgcagcgt
tccggtttccctgatctgctggtgcaaacgctgatcgccaccgaagaccgccatttctat
gagcatgacggcatcagtttctactctatcggccgtgcgttggtcgccaacctgacggcg
ggccgggcggtgcagggcggcagtacgctgacccagcagctggtgaaaaacctgtttctg
accaacgaacgctcgttgtggcgtaaagccaacgaagcctacatggcgttgatcatggat
taccgctacagcaaggatcgcattctggagctgtatctgaacgaggtgtatctcggccag
agcggcaacgatcagatccgcggttttccgctggccagcctgtactatttcggccggccg
gtcaacgaactgagccttgatcagcaggcgatgctggtggggatggtgaaaggggcgtcg
ctgtataacccgtggcgcaacccgcaggtaacgctggaacgccgtaatctggtgttgaag
ctgctgcaaaaccagcaggtcatcgacgaagatctttacaacatgttgagtgcccgcccg
ttgggggtccagccgaaaggcggggcgattagcccgcagccggcgttcatgcagatggtg
cgccaggagttgcagcagcggctgggcgacaaagccaacgatctgtccggggtgaagatt
ttcaccacgctggatccggtatcgcaggatgcagcggaaaaagcggtggaagacggcatt
ccggcgctgcgcgcggcgcgcggggtcaaggatctggaatcggcgatggtgatcgtcgat
cgcttcagcggcgagattcgggcgatggtgggcggttccgatgcgcaatttgccggtttt
aaccgtgcgatgcaggcgcgccgttcggtcggttcgctggcgaaaccgccgacgtatctg
accgcgctcagtatgccggatcgttatcgcctcaacaccattttggtggatgagccgatt
tcgctcaagcagccgaacggtacggtttgggagccgaaaaactacgatcgtgagttccgt
ggccgggtgatgctggtggacgcgctggcgaattcgctcaacgtgccgacggtcaatctg
gggatggcggtcgggctggatcaggtcagcgatacgttgcagaagctggggatcccgcaa
aaccagattcaggcggtgccggcgatgttgctcggcgccgtcagcctgacgccgatggaa
gtggcgcaggaataccaaactatcgccagcggcggcagtcgtgcgacgctttctgccctg
cgctcggtgattgctgaagacggtaaggtgctgtatcagagcttcccgcaagctgaacgg
gcggtgccgtcacaggctgcttacctgacgttgtatggtatgcaacaggtggtagagcgg
ggcacctcacgttcgctgacggtgaaattcggcaattaccacctggcggggaaaaccggg
accaccaacgacctgcgcgacagctggtttgccggcgtcgacggcaaagaagtggtgatc
acctgggttggccgtgacaacaatggcccggcgaaactgaccggcgccaatggcgcgctg
actatctatcgtcgctatctggaaaatcagacgccgttgccgctggtgctgacgccgccg
gaaggcattaccaccatgtcggtggatggcagcggcaacgttatctgtaacggcagcgcc
ggccgggcattgccggtgtggagcgataacccgcaggcgttgtgccaggccagccagcaa
gcggtgcaacagccgacgaattcgccgaatggtcagccacaacaaaatcagcaggaaggc
ggcagcgtgcctgactggatcaagcagatgttcgggcagtaa

DBGET integrated database retrieval system