KEGG   Dickeya chrysanthemi: Dd1591_2395Help
Entry
Dd1591_2395       CDS       T00930                                 

Definition
(GenBank) Beta-lactamase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
dze  Dickeya chrysanthemi
Pathway
dze00550  Peptidoglycan biosynthesis
dze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dze00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Dd1591_2395
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dze01002]
    Dd1591_2395
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dze01011]
    Dd1591_2395
Enzymes [BR:dze01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Dd1591_2395
Peptidases and inhibitors [BR:dze01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   Dd1591_2395
Peptidoglycan biosynthesis and degradation proteins [BR:dze01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Dd1591_2395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ACT07236
UniProt: C6CKC1
LinkDB All DBs
Position
complement(2739983..2741191)
Genome map
AA seq 402 aa AA seqDB search
MKIMTPHISWRHAVVAATGVLMVVSSGLRAEQTPPPPQIDAKAFILIDSASGRVLAESNA
DTRLDPASLTKIMSSYVIGQAIKVGKIKPEDKVTVGKDAWATGNPSLRGSSLMFLKPGDQ
ISVSDLNKGMVIQSGNDASIALADYVAGSQDAFVSLMNQYALNLGLTNTHFLTVHGLDTP
GQYSTARDMARLTQALIRDVPSEYALHSEKEFTFNNIRQPNRNRLLWSGNLRVDGVKTGY
TDGAGHSLVASAVDGDMRLISVVLGAPSDAVRFRESEKLLTWGFRFFETATLVRSDTPFT
THRVWFGSEKQARLGVAQDAALTVPKGQTKNLKVSFTLAQPQLKAPLKKGQVVGTIDFQL
DGASIGQRPLVVMDDIPEAGFFSRLWDTVLMTLSGWFGGLWG
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaagataatgacacctcacatttcctggcggcacgcagtcgtagcagcgactggggta
ctgatggtcgtttcgtcggggcttcgcgccgaacagacgccgcctccgccacaaattgac
gccaaggcttttattttgatcgattccgccagcggtcgggtgctggcggagtcaaacgcc
gatacccggctggaccccgccagcctgacgaagatcatgtcgagctatgtgattgggcaa
gccataaaagtaggaaagattaagcccgaagataaggtaaccgttggaaaagacgcctgg
gcgaccggtaatccatcactccgtggctcttcactgatgtttctcaagccgggtgaccag
atttcggtgtccgatcttaataaagggatggtgattcagtccggcaatgatgccagtatc
gctctggcggattatgtggcgggcagccaggatgcgttcgtcagcctgatgaatcagtat
gcgcttaacctcggtttgacgaatacccattttctcacggttcacggtttggatacgccc
ggacaatacagcaccgcccgcgatatggcgcgcctgacgcaggcgttgatccgcgatgtt
ccgagcgagtacgcgttacacagcgaaaaagaatttacgtttaataatattcgtcagcca
aaccgtaatcgcctgctgtggagcggcaatctgcgggtcgatggcgtgaaaaccggctat
accgatggggccggtcatagcctggtggcctcggcggttgatggggacatgcggttgatt
tccgtggtgctgggcgcgccgtctgatgccgtgcgctttcgggaaagcgaaaaattgctg
acctgggggttccgtttctttgaaacagcgacgctggtacgcagcgatacgccgtttact
acccatcgggtgtggttcggcagcgaaaagcaggcccggctaggcgtcgcacaggatgcg
gcgctgactgtgccaaaagggcagacgaaaaacctgaaagtcagttttacattggcccag
ccgcaactgaaagcgccgctgaagaaagggcaggtcgtcgggacgatagatttccagttg
gatggcgccagtatcggccagcgcccgctggtggtgatggacgacataccggaagccggc
tttttcagtcgcctgtgggatacggtgctgatgacattatccggatggttcggcgggtta
tggggttaa

DBGET integrated database retrieval system