Dickeya chrysanthemi: Dd1591_2908 Help Entry Dd1591_2908       CDS       T00930                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism dze  Dickeya chrysanthemi Pathway dze00190   Oxidative phosphorylation dze01100   Metabolic pathways dze02020   Two-component system Module dze_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:dze00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Dd1591_2908  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Dd1591_2908 Enzymes [BR:dze01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      Dd1591_2908 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ACT07730 UniProt:  C6CPS7 LinkDB All DBs Position complement(3310287..3310403) Genome browser AA seq 38 aa AA seqDB search MWYFAWILGTLLACSLGVITALALEQSEATKTNQDKPQ NT seq 117 nt NT seq  +upstreamnt  +downstreamnt atgtggtattttgcctggatattgggaacgcttcttgcttgctcgctgggcgtgattacc gctctggcacttgaacagagcgaagcaaccaagacgaatcaagataaaccgcaatga

DBGET integrated database retrieval system