KEGG   Durio zibethinus (durian): 111281283Help
Entry
111281283         CDS       T05242                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00052  Galactose metabolism
dzi00500  Starch and sucrose metabolism
dzi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    111281283
   00500 Starch and sucrose metabolism
    111281283
Enzymes [BR:dzi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     111281283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 111281283
NCBI-ProteinID: XP_022724736
LinkDB All DBs
Position
Unknown
AA seq 905 aa AA seqDB search
MDAAEEKHYFHNLFLFLIIFSFSYSVHGVNEAVGYGYKLESVSIDSNQKWLTARLGLIRS
SSVFGPDIQNLNLFASFETSNRLRIRVTDSGHQRWEIPQEIIPRQSQFPHLSLLEDRLST
SANYQTQKQKENYFVSDPTSDLIFSLHNTTPFGFTVRRRSSGDILFDASPDASDPGTFLV
FKEQYIQLSSSLPKDRSSLYGLGEHTKGSFKLQHNDTLTLWNADLASANLDVNLYGSHPF
YMDMRSASADGKVAAGTSHGVVLLNSNGMDIVYGGNRITYKVIGGVIDLYVFGGPLPHAV
IEQYTELIGRPAAMPYWSFGFHQCRYGYKNVSDLEGVVAGYSKARIPLEVMWTDIDYMDA
FKDFTLDPINFPKDLMKKFVDKLHQNDQKYVVILDPGISVNKTYGTYIRGMQADIFIKRD
GVPYLGVVWPGPVYFPDFVNPLTETFWAGEIKIFRDFLPVDGLWLDMNEISNFITSPGKP
NSTLDNPAYKINNQGIQRPINNKTVAATSLHFGNLTEYNVHNLYGLLECKATHAALTNLT
GKRPFILSRSTFASSGQYAAHWTGDNAARWEDLAYTIPSILNFGLFGLPMVGADICGFSG
DTTEELCQRWIQLGAFYPFARDHSEINSIRQELYLWDSVAATARKVLGLRYRLLPYFYTL
MYEAHKKGIPIARPLFFTFPQDVKTYEINSQFLLGRGVMVSPVLKRGVVSVHAYFPTGNW
FDLFNYSNSVSANPGKYFTLAAPRDHINVHVRESNIIAMQGEAMTTAAARKTPFQLLVAV
SNSENMSGELFLDDGEEVEMGQEGGKWSLVRFYGVSSGDNVHVRSEVENGEFALSQKWII
NKVTFVGLEKIGRLKGYEISTNNRTNLSENPILKTKLDKNAKFQVVVLSRLRLPVGKEFS
LQLRF
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atggatgcagcagaagaaaagcactattttcataatctatttctgtttttaatcatcttt
tctttttcttactcggttcatggggttaatgaagctgttggatatggctacaaacttgaa
tctgtttccattgactcaaaccaaaaatggttgaccgcccgtctaggtcttatccgcagc
tcatctgtttttggacctgacattcaaaatctcaatctttttgccagctttgagacaagc
aatcgattgagaatcagagttacagattcaggccatcaaagatgggaaatcccacaagaa
atcataccccgtcaatctcagttcccacacctatcattgctagaagaccgtctgagcaca
tcagcgaactaccaaacacagaagcaaaaggaaaactattttgtgtcagacccaacatcg
gacctcattttcagcctacataacaccacgccattcgggttcacagtgaggcgtcgctcc
tcaggtgacatccttttcgatgcatctccggatgcatccgatcctggcactttcttggtg
ttcaaggaacaatacattcaactctcctcctcacttccgaaagataggtcttcactttac
ggactgggagagcacacaaagggatcgtttaagttgcaacacaatgacacattgacgcta
tggaatgcagatttggcgagtgctaatctggatgttaatctttatggatcacatcccttt
tacatggatatgagatcagcatcagcagatggcaaagtagcagccggaactagccatgga
gtggtgttgcttaatagcaatggaatggacattgtgtatgggggaaacaggataacttac
aaggttattggaggagttatagatttgtatgtttttggtggaccactgccccacgctgtc
attgagcagtacactgagcttattggccgccccgctgccatgccttactggtcctttgga
ttccatcagtgccggtatggctacaaaaacgtttctgatcttgagggtgtggttgcgggc
tactcaaaagctaggattccactggaagtcatgtggacagacatcgattacatggatgcc
tttaaggatttcactcttgaccccatcaactttcccaaggacctgatgaaaaaatttgtc
gataagcttcatcagaatgaccagaaatatgtggtcatcttagatcctggtatcagcgta
aacaaaacctatggaacctacatcagagggatgcaagctgatatattcataaaaagggat
ggagtcccttacttgggtgtagtttggcctggtccagtttacttcccagattttgtaaat
cctcttactgaaacattttgggctggtgaaatcaaaatatttcgagattttctccctgtt
gatggtctttggcttgatatgaacgagatatccaatttcataacctcccctggaaagcca
aattctaccctggataatcctgcttacaagattaacaatcagggaatccagcgacctatt
aataataaaacagttgcagccacatctctacattttggtaatctgacagagtataatgtc
cataacctgtatggtttactagaatgcaaagctactcacgcagcattgactaatttgacc
ggcaaaaggccatttattctgagtagatcaacttttgcaagctctggacaatatgcagcc
cactggaccggagacaatgcagccaggtgggaggatttggcatacacaataccatcaatt
ttaaatttcggactctttggtcttccaatggttggagctgatatatgtggcttttctggg
gatacgactgaagagctctgccaaagatggattcaactaggggccttttacccttttgct
agagatcactctgagattaattcaattcgtcaagagctctatctttgggattcagttgct
gcaacagctaggaaggtgcttggcctccgctatcgcctgctcccatacttttacactcta
atgtacgaggcacacaaaaaagggattcccattgcaaggccacttttcttcacattcccc
caagatgttaagacttatgaaatcaattcacaatttctccttggtagaggtgtaatggtg
tcacctgtattaaagcgaggagtcgtttcagttcatgcttacttcccaactggaaactgg
tttgacctcttcaattattccaactcagtgagtgcaaatcctggaaaatattttacacta
gctgcacctcgtgatcatataaacgtgcatgttcgggaaagtaacattatagccatgcaa
ggagaggccatgacaacagcagctgcccggaaaacaccattccaactcttggtggctgtc
agcaacagtgagaatatgagtggggaacttttcttggatgatggagaggaagtggagatg
ggacaagagggaggaaagtggagtttagtgagattttacggggtaagttctggtgataat
gtccatgtcagatcagaggttgagaatggagaatttgctttgagtcaaaagtggatcata
aataaagtcactttcgtggggttggaaaaaattgggaggctgaaggggtatgaaataagc
accaacaacagaacaaacttgtctgaaaatccaattttgaagacaaaattagacaagaat
gcaaaattccaagttgtggtgctctcaagactgaggctacctgttggaaaggagttcagt
ttgcaactcaggttttaa

DBGET integrated database retrieval system