KEGG   Durio zibethinus (durian): 111284200Help
Entry
111284200         CDS       T05242                                 

Definition
(RefSeq) hexokinase-1-like isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00010  Glycolysis / Gluconeogenesis
dzi00051  Fructose and mannose metabolism
dzi00052  Galactose metabolism
dzi00500  Starch and sucrose metabolism
dzi00520  Amino sugar and nucleotide sugar metabolism
dzi01100  Metabolic pathways
dzi01110  Biosynthesis of secondary metabolites
dzi01200  Carbon metabolism
Module
dzi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dzi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111284200
   00051 Fructose and mannose metabolism
    111284200
   00052 Galactose metabolism
    111284200
   00500 Starch and sucrose metabolism
    111284200
   00520 Amino sugar and nucleotide sugar metabolism
    111284200
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    111284200
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dzi04131]
    111284200
Enzymes [BR:dzi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     111284200
Membrane trafficking [BR:dzi04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    111284200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Rhabdo_ncap_2 DUF1731
Motif
Other DBs
NCBI-GeneID: 111284200
NCBI-ProteinID: XP_022728659
LinkDB All DBs
Position
Unknown
AA seq 498 aa AA seqDB search
MGKVAMGATVVCAAAVCAAAALVVRHRMKSSGKWARALAILKEFEEKCGTPSSKLKQVVD
AMTVEMHAGLASEGGSKLKMIISYVDNLPTGDEKGLFYALDLGGTNFRVLRVLLGGKESH
VVKQEFEEVSIPPHLMTGFSDALFDYIASALAKFVATESDSLHVSPGRQRELGFTFSFPV
RQTSISSGTLIKWTKGFSIDDTVGQDVVGELTKAMERIGLDMRVAALVNDTIGTLAGGRY
NNPDVVAAVILGTGTNAAYVERAHAVPKWHGLLPKSGDMVINMEWGNFRSSHLPLTEYDQ
TLDAESLNPGEQIFEKMISGMYLGEIVRRVLCKMAEEAAIFGDTVPPKLKIPFILRTPHM
SAIHHDMSPDLKVVGTKLKDVLEISNTSLKIRKVIVELCDIVATRGARLSAAGIVGILKK
LGRDTVKDGEKQKSVVALDGGLYEHYAKFRTCMENTLRELLGEEVSENIVVEQSNDGSGI
GAALLAASHSQYIEVEEP
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggtggcgatgggggcgacggtggtgtgcgcggcagctgtgtgtgctgcggcg
gcgctggttgtgcgtcataggatgaagagttcggggaagtgggcccgggcgctggctatc
ctgaaagagttcgaggaaaagtgtgggaccccaagttcgaagctgaaacaggtggtggat
gctatgaccgttgagatgcacgctgggctggcctcggaaggtggcagcaagctcaagatg
attatcagctatgtagataatctccccaccggtgatgagaaaggactgttttatgccctc
gaccttggtggcacaaatttccgtgtcctacgtgtactcttgggtggtaaagaaagccat
gttgttaagcaggaatttgaggaagtttcaattcctccacatttgatgactggattttca
gatgcattatttgattatattgcttcagctcttgcaaaatttgttgctacagaaagtgac
agtttacatgtttcacctggtagacaaagggagctggggttcactttctcatttcctgtt
aggcaaacatcaatatcatcagggactcttataaaatggacaaagggcttctcgatagat
gatacagttggacaggacgttgttggagaattgacaaaagctatggaaaggattggcctt
gacatgcgtgtggcagctttggtcaatgatacaattggcactttggctggtggtagatac
aacaaccctgatgttgttgctgctgtgatattgggtacaggcacaaatgcagcttatgta
gagcgtgcccatgcagttcccaaatggcatggtcttctacctaaatcaggggacatggtt
atcaacatggagtggggtaactttcggtcttcacaccttccactaacagaatatgatcaa
actctggatgctgagagtttaaaccctggagaacagatttttgaaaaaatgatttctggt
atgtatttgggagagattgtacgtagagttttgtgcaagatggctgaggaagctgcaatt
tttggtgatactgttccaccaaaattgaaaattcctttcatactaagaactcctcacatg
tctgcaatccatcacgacatgtctccagatctgaaagtggttgggaccaaactaaaggat
gtattagagatatcaaatacctccctgaaaataagaaaagttattgttgagctgtgcgac
attgttgctactcgtggtgcccgcctatctgctgctggaatcgtgggtatcctcaagaaa
ttaggaagagatacagttaaagatggtgaaaaacagaagtcagtggtagctctagatggt
ggattatatgagcactacgctaaattcaggacctgcatggagaacaccctcagggagttg
ctgggagaagaagtctccgagaacattgtagttgagcaatccaatgatggctctggcatt
ggggcagccctccttgcagcctctcactcccaatacattgaggttgaggagccctga

DBGET integrated database retrieval system