KEGG   Durio zibethinus (durian): 111287216Help
Entry
111287216         CDS       T05242                                 

Definition
(RefSeq) alpha-amylase 3, chloroplastic-like
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00500  Starch and sucrose metabolism
dzi01100  Metabolic pathways
dzi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    111287216
Enzymes [BR:dzi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     111287216
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70 DUF5089
Motif
Other DBs
NCBI-GeneID: 111287216
NCBI-ProteinID: XP_022733308
LinkDB All DBs
Position
Unknown
AA seq 892 aa AA seqDB search
MATVAIDSLLQNPRLSVSPKAKVLLQPSRSLNCSRNRKLLFSRGACFCSFKPRRQIHVVN
ASSTDTALIDTFDTSSSDDVLYKETFPVKRIDKVEGKIFISLDQSKDQRNWQLTIGCSLP
GKWILHWGVSYVGDNGSEWDQPPKEMRPPGSIPIKDYAIETPLKKLSKGDMFHEVKIKLI
PRSGIAAIHFVLKDEETGAWYQHRGRDFKVPLVDYLEDDGNMIGPKRGFGIWAGALGQLT
NMLLKAEASPANSQKSSSESNDSKNQTRQREGFYEEQPIVKEVSIGNLVSVAARKSPDTT
KNVLYLETDIPGDVLVHWGVCRDDSKTWEIPAAPYPPETAVFKNKALRTLLQPKSIGHGS
RALFTLDEEIVGFLFVLKLDDNTWLNFKGNDFYIPLTGASSVPGQHGESDTSSEEISSKA
YTDGIINEIRNLVSGINSEKSQKTKTKEAQESILQEIEKLAAEAYSIFRSSIPTFSEEVV
LETEAPKPSVKIPSGTGTGFEILCQGFNWESHKSGRWYMELKEKALEISSLGFTVIWLPP
PTESVSAEGYMPTDLYNLNSRYGTIDELKELVKNLHDAGLKVLGDVVLNHRCAHFQNQNG
VWNIFGGRLNWDDRAVVGDDPHFQGRGNKSSGDNFHAAPNIDHSQEFVRKDLKEWLVWLR
DEIGYDGWRLDFVRGFWGGYVKDYLDASTPYFAVGEYWDSLSYTYGEMDHNQDAHRQRII
DWINATNGTAGAFDVSTKGILHSALERCEYWRLSDQKGKPPGVVGWWPSRAVTFIENHDT
GSTQGHWRFPGGKELQGYAYILTHPGTPAVFYDHIFSHYRSEIAALISLRNRNKIHCRST
VKIVKAERDVYAAIIDEKVAMKIGPGYYEPPGGPQRWSSVLEGKDYKVWEAC
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgttgccatagattctcttctccaaaaccctaggctatcagttagtcccaaa
gctaaggtgttgctacagccgtctcgatcattgaattgttctcgaaatcgaaagcttctc
ttctcccggggcgcttgtttctgtagcttcaagcctcgccggcagattcatgtcgtcaac
gccagttccactgatacagctctcattgacaccttcgacacctcttcttccgatgacgtc
ttgtacaaagagacgtttcctgtcaagcgaattgataaggtggagggaaaaattttcatc
agtttagatcaatcaaaggatcagcggaattggcagcttacaataggatgtagtcttcca
ggaaagtggattcttcattggggagtttcttatgttggtgataatggcagtgaatgggat
caaccgcctaaagaaatgagacctcctggttcaattcccattaaagactatgcgattgag
actcccttgaagaaactgtctaaaggagatatgtttcatgaagtaaagattaaattaatt
cccaggagtggaattgcagctatacattttgtcctaaaggatgaagaaactggagcctgg
tatcagcacagaggtagagattttaaggtccctcttgtggattaccttgaggatgatggc
aatatgattggaccgaaaaggggctttggcatatgggcaggtgccctggggcagttaact
aacatgctacttaaagcagaagcatcacctgctaatagtcaaaagagcagcagtgaatcg
aatgactctaaaaatcagactaggcagcgtgaaggattctatgaagagcagcctattgtg
aaagaagtttctattggtaacttagtgagtgttgctgctaggaagtctcctgatacaacc
aaaaatgttctgtatttagaaactgatatacctggagatgttttagttcactggggtgtt
tgcagagatgatagtaaaacatgggaaattcctgctgccccatatccaccggaaacagct
gtattcaagaacaaggctttacgtactttattgcagccaaaaagtataggacacggatca
agagcattattcactttagatgaagaaattgttggatttcttttcgtcctcaagctagat
gataacacttggttgaattttaaaggaaatgacttttatattcccctcactggtgcaagt
agtgttccaggtcaacatggtgaatctgacacttcaagcgaagaaatttctagtaaagca
tatactgatggtatcatcaatgagatacggaacttggttagtggcattaattctgaaaag
agtcagaagaccaaaacaaaggaagcacaagaaagcattcttcaagaaattgaaaaacta
gctgctgaagcctatagcatcttccggagctccattccaaccttttcagaggaagttgtt
ttggaaactgaggcaccaaaaccctctgttaaaataccctctggaacaggcacaggtttt
gaaatattgtgccaaggtttcaactgggaatctcataaatccggtcgatggtatatggaa
ctcaaagaaaaagctttagaaatatcttctcttgggtttactgtgatttggctaccacca
ccaacagagtctgtgtcagctgaagggtatatgccaacggatttgtataatttaaattcc
agatatggaactattgatgagctgaaggaacttgtaaagaacctccatgatgccggtttg
aaagttcttggtgatgttgtattgaatcaccgttgtgcacactttcaaaatcagaatggt
gtatggaatatatttggtggtcgcttaaattgggatgaccgggcagtcgtcggagacgat
cctcattttcagggcaggggcaacaaaagtagtggagataatttccatgctgctccaaac
attgatcattcacaagagtttgtgaggaaggacctcaaagaatggctagtctggctgaga
gatgaaattggttatgatggatggaggctggattttgttagaggattttggggtggttat
gtcaaggactacttggatgcaagtacaccttactttgctgtgggtgagtattgggattct
ctcagctacacctatggtgaaatggaccacaatcaagatgcccacagacagagaattatt
gattggatcaatgctactaatggaactgctggtgcatttgatgtctcaacgaaaggaatt
cttcattctgctctggaaagatgtgaatattggcgattatcggatcaaaaagggaagcct
cctggggttgttggatggtggccatctcgtgctgtgacctttatagagaatcatgacact
ggttctacccagggtcattggaggtttccaggtggaaaggaactgcaaggatatgcttat
atcttgactcatccaggaacaccggctgtgttctatgatcacattttctctcattatcga
tcagaaattgctgctcttatctctctcagaaacagaaacaaaatccattgccggagtaca
gttaaaattgtcaaggcagagagggatgtatatgcagccatcattgatgaaaaagttgca
atgaagattggaccaggttattatgagcctccaggtggaccccaaagatggtcctcagtc
cttgaggggaaggattacaaggtctgggaagcatgttaa

DBGET integrated database retrieval system