KEGG   Durio zibethinus (durian): 111291647Help
Entry
111291647         CDS       T05242                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF-like isoform X1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    111291647
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dzi03036]
    111291647
Enzymes [BR:dzi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     111291647
Chromosome and associated proteins [BR:dzi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     111291647
   Polycomb group proteins
    PRC2-EZH2 complex
     111291647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 111291647
NCBI-ProteinID: XP_022739201
LinkDB All DBs
Position
Unknown
AA seq 953 aa AA seqDB search
MAAKSSPSDSVDRSEPPNDSSMTQTEENTVTVKEVLLIIDSLKKQVTADRSVYVKKRLEE
NRQNLGGITSHLYKLSNERRSSWISDTDSASDLLTKRQKDALSMQNGFDISDGDKDSYSY
QEPSTAVLMGSSIPVKNAVRPVKLTEVKKLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYD
QNGGEALICSDSEEEAIEEDEEKRDFAESEDFILRMTIKEVGLSDPVLESLAQCLYRSPS
EVKARYETLMKEGKDAGASKNGDIEAQNWNSFLEKDLEAALDSFDNLFCRRCLVFDCRLH
GCSQDLIFPADKQTPWNHPDEENEPCGPHCYRLVLNSERNGTVSTPMNPKEKSNSSSDGV
GAQTSSRKKSSGPYARRKVKSCQSESALSNAKNLSESSDSEIGPRHENSLSPIPQLSPSK
NKIAGKSGILKRNSKRVAERVLICMRKRQKKMAASYSDSVVSGGVSPTDMKLRSNAWKEN
EDSTSSSQKNVKSPNTGRSRRKEWPLQEGEKGEVPEVPSSETINELARSSSNYGLRKEEF
VDENLCKQELSDDKSWKAIEKGLFEKGVEIFGTNSCLIARNLLNGLKTCWEVFQYMTCSD
NKLACHAADGVISLLEGYSKFDLNGTMGNNEVRRRSRFLRRRGRVRRLKYTWKSAAYHSI
RKRITERKDQPCRQYNPCSCQTACGKQCACLLNGTCCEKYCGFMVNTCVDDILMLIHLFS
FLLFAHLYRCPKSCKNRFRGCHCAKSQCRSRQCPCFAADRECDPDVCRNCWVSCGDGTGT
LGAPPQRGDNYECRNMKLLLKQQQRVLLGRSDVSGWGAFLKNSVGKHEYLGEYTGELISH
READKRGKIYDRENSSFLFNLNDQFVLDAYRKGDKLKFANHSPDPNCYAKVIMVAGDHRV
GIFAKERINAGEELFYDYRYEPDRAPAWARKPEASGSKKEDGAPSSGRAKKLA
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaaatcttcgccttctgattcggtggatagatcggaacctcccaatgactcc
tcgatgacacaaactgaagaaaacactgtgactgttaaggaggttttattgataattgat
tcattaaagaagcaagttacagctgaccgatctgtttatgtgaagaaaagattggaagaa
aacaggcaaaatttgggtggtataacgagccatctttataaattgtcaaatgaaagaaga
agcagttggattagtgatactgacagtgcttcggatctattgacaaagaggcaaaaagat
gcacttagtatgcaaaatggttttgacataagtgatggggataaggatagttatagctat
caagaaccttctacagcagttcttatgggatctagtattccagtcaagaatgctgttcgt
cctgttaagcttacagaagtgaaaaagctaccgccttatactacatggatatttctggac
agaaatcaaagaatgacagaggatcaatcagtggtaggtcgaaggagaatctactatgat
caaaatggtggtgaagcacttatctgcagtgacagtgaggaggaagcaattgaggaagat
gaagaaaagagagattttgcggaatctgaagactttattcttcgaatgaccatcaaggaa
gttggtttgtcggatccagtactggaatcactagcacaatgtttgtatagaagtccttct
gaagtcaaggcaagatatgaaactcttatgaaggaagggaaggatgctggggcctctaag
aatggggatattgaagcacaaaattggaattcctttcttgaaaaagatcttgaagcagct
cttgattcttttgacaatttattttgtagacgatgccttgtctttgattgcagattacat
ggatgctctcaggaccttatctttcctgctgataaacaaactccatggaaccatccagat
gaagagaatgaaccatgtggtccgcactgctatcgtttggtgcttaactcagaacgaaat
ggcacagtcagcactccaatgaatcccaaagaaaagtcaaactcttcatctgatggtgtt
ggggcacaaacgtcatcccgtaagaaatcttctggtccatatgctaggaggaaggtaaag
tcctgccaaagtgaaagtgctttgtccaatgctaaaaatctttcagaaagtagtgactca
gagattggacccaggcatgaaaactccttgtcgcctattccccagttatcaccttctaag
aataaaattgctggaaaatctggaattctcaagaggaatagcaagcgagtcgctgaacgt
gttttaatttgcatgcgcaagaggcagaagaagatggcagcttcgtattctgattctgtt
gtgagtggaggtgtttcgccaacagatatgaaactgaggtctaatgcatggaaagaaaac
gaagattctacatcttcttcgcagaagaatgtgaaatctccaaacacaggaaggtctagg
aggaaagagtggccattacaggaaggagagaaaggagaagttcctgaagttccttctagt
gagactattaatgaattggctcggtctagtagcaattatggcctgagaaaagaagagttt
gtggatgaaaacttatgtaaacaagaactaagtgatgataaatcttggaaagctattgaa
aaaggtctttttgagaaaggtgtggagatttttggcacgaacagctgtttgattgccaga
aatcttttaaatggattgaagacatgttgggaagttttccaatacatgacctgctctgac
aataaactggcttgccatgcagctgatggtgttatatctcttcttgaagggtattccaag
tttgaccttaatggaaccatgggaaataacgaagtacgacgcagatcaagattcttgcgt
agaaggggtagggtccgtcgtttgaaatatacctggaaatcagctgcatatcactcaatc
aggaaaaggattactgagaggaaagatcaaccatgccggcagtataatccatgtagttgt
caaacagcttgcggaaagcaatgtgcttgccttttaaatgggacttgctgtgaaaaatac
tgcggatttatggttaacacatgcgttgatgatatcttgatgttgatccatttattctct
ttcctgctctttgctcatttatatagatgtcctaagagttgcaagaatcgatttagaggt
tgtcattgtgctaaaagtcaatgtcgaagccgtcagtgtccatgctttgctgcagacagg
gaatgtgatccagatgtttgtagaaattgttgggtcagttgtggtgatggcactggtaca
cttggagcccctccacaaaggggtgacaattatgaatgcagaaatatgaagcttcttctc
aaacaacagcaaagggtgttgcttggaagatctgatgtttctggatggggagctttcttg
aagaatagtgttggcaagcatgaataccttggtgagtacactggggagctgatttcacat
cgggaagcagataagcgtggaaagatatatgaccgtgaaaattcttcatttctcttcaat
ctgaatgatcagtttgttcttgatgcttaccgaaagggtgacaaattgaagtttgccaac
cattctcctgatcctaattgctatgcaaaggtcattatggtggcaggggatcatcgggtg
ggtatatttgccaaagaacgaattaatgcaggggaggaacttttctatgactatcgttac
gagcccgacagagctcctgcttgggctagaaagcctgaggcctctgggtccaaaaaagag
gatggggctccttcaagtggacgagcaaagaagcttgcttaa

DBGET integrated database retrieval system