KEGG   Durio zibethinus (durian): 111291933Help
Entry
111291933         CDS       T05242                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00020  Citrate cycle (TCA cycle)
dzi00190  Oxidative phosphorylation
dzi01100  Metabolic pathways
dzi01110  Biosynthesis of secondary metabolites
dzi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111291933
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    111291933
Enzymes [BR:dzi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     111291933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 111291933
NCBI-ProteinID: XP_022739802
LinkDB All DBs
Position
Unknown
AA seq 641 aa AA seqDB search
MWRFFSRSLRVPYSKRSVANDSLRSHISRFFSTDAGEAPYTFWPKKESPYTIVDHTYDAV
VIGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYD
TVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQ
AYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTL
HRFHAASTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAG
CLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHI
YLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEAVTI
RGSDPDSVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIHRPGEKQKP
LEKDAGEKTIAWLDKIRNSNGSLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCHLIDKAW
ESFHDVKLKDRSLIWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDA
NWMKHTLGYWDNEKVRLDYRPVHMNTLDDEVESFPPKARVY
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcttcttttctcgtagccttcgtgttccatattcgaagagatcggttgctaat
gactctcttagatctcacatttccagattcttctccaccgatgctggtgaagccccttat
acgttttggccaaaaaaagaatccccttatacgattgtagatcatacatatgatgcagtc
gtgattggtgctggtggtgcgggactcagagcagccatcggtctttcagagcatggattt
aatactgcttgcattactaagcttttcccaacacgttcgcatactgttgcagcccagggt
ggcataaatgctgctttgggaaatatgactgaagatgactggagatggcacatgtatgac
acagttaaaggaagtgactggttaggtgatcaggatgcaattcaatatatgtgcagggag
gcaccaaaagcagtgattgaacttgagaattatgggctgcctttttctcgaaccgaagat
gggaaaatatatcagcgtgcgtttggtggtcaaagccttgactttggaaaaggtggacag
gcttatcgttgtgcatgtgctgctgatcgaacggggcatgctctattgcacactctctat
ggccaagctatgaaacataatacccaattctttgtggaatattttgctttggatctgttg
atgaatagtgatggaagctgccagggagtgatagctttgaacatggaggatggaacacta
catcgattccatgctgcttcaacaattctggcaactgggggatatggtagagcctatttt
tctgcaacctcagctcacacatgcactggtgatggcaatgctatggttgcacgtgctggg
cttcccctccaggatttggagtttgtgcaatttcatccaactggaatttatggggctggg
tgcctcatcactgaagggtctcgtggtgaaggtggtattcttagaaatagtgaaggtgaa
cgctttatggaacggtatgcccctacagccaaggatcttgcttcaagggatgttgtttca
agatctatgaccatggaaatcagggaaggtcgtggtgtaggacctttgaaggatcatatc
tatctccacttgaatcacttacctccagaggtgctcaaagagaggcttccaggtatctct
gagactgccgccatttttgctggtgtggatgttacaaaggagcccatcccagtcttgcct
actgtacattataacatgggtggaattccaacaaattaccatggagaggcagttactatt
agaggcagtgatccagattctgtggttcctggactaatggctgctggagaagcagcttgt
gcatcagttcatggtgccaatcggttgggtgcaaattcccttcttgacattgttgtcttt
ggtcgggcttgtgcaaaccgagttgcagagatccatagaccaggggagaagcagaaacct
ttggaaaaggatgctggtgagaaaacaattgcatggctggacaaaattagaaattctaat
ggttctcttccaacttcaaaaattcgattaaatatgcaacgagtaatgcaaaacaatgct
gccgttttccgcacacaggaaacactagaagaaggttgtcatttaattgataaggcatgg
gaaagtttccatgatgttaagttgaaggatcgaagtttaatatggaactctgatttgata
gagactatcgagttggaaaatcttttaataaatgcctgtatcaccatgcattctgctgaa
gctaggaaagagagcagaggagcacatgcccgtgaagattttacgaaaagagatgatgcg
aactggatgaaacacacattgggctattgggataacgagaaggtgcgactggattaccgg
ccggttcacatgaacacattagatgatgaggttgagtcattcccacctaaagcccgtgtg
tattaa

DBGET integrated database retrieval system