KEGG   Durio zibethinus (durian): 111292798Help
Entry
111292798         CDS       T05242                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN1-like
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00562  Inositol phosphate metabolism
dzi01100  Metabolic pathways
dzi04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111292798
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    111292798
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dzi01009]
    111292798
Enzymes [BR:dzi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     111292798
    3.1.3.48  protein-tyrosine-phosphatase
     111292798
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     111292798
Protein phosphatases and associated proteins [BR:dzi01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    111292798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase3 Y_phosphatase PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 111292798
NCBI-ProteinID: XP_022741118
LinkDB All DBs
Position
Unknown
AA seq 420 aa AA seqDB search
MFNPIGISQMGLKFTKQVPGKAGNTTLVLQNRMLSYLTASSFIRNLVSKKRRRMVVGGYD
LDMSYITDRVLAMSFPAEHMRAMYRNPLWQVKSVLEMRHQGHYKIYNLCIEEDYDPSHFH
GRVEKFPFDDNHVPNFEMMKLFCESVHSWLSNDPKNIAVIHCMAGKGRTGLMVCAYLIYT
GMLAEEAFQLYAQKRTTNNEGVSIPSQRRYVGYWEKILSFPTGVSNGPPDVNLPQPCSRE
LWRIRLYDTVNTTSVFFVVSELQEIPGQLYHPPVEVAKRCCREITKGCEANCSPRYFLSF
VEGDEEGTTSESEPRVVVQMDTESPVLYQKTCLDYHFSKPVQVSGDMRIIFYQKMIGGRL
FYACFNTAFIKNSLLQFTIRDLDKVGSKGRSICGPAFCVELLFGPANPKNSMLCSSDFDK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaccccattggtatcagccaaatggggttgaaatttacaaagcaagtgccagga
aaggctggaaacaccactctagtcctccagaaccgaatgctctcttatcttacggcaagt
tcttttattcggaacctggtgtccaagaaaagaaggcggatggttgttggtggctatgat
ctggacatgtcatatataacagatcgtgtattggcaatgtcgtttcctgctgaacatatg
cgagcaatgtatcgtaatcctctatggcaggtgaagtctgtgctggaaatgagacatcag
gggcattacaagatctacaacttgtgcatagaagaagactatgatccatcacactttcat
ggccgtgttgagaagtttccttttgatgacaatcacgttccaaatttcgaaatgatgaag
ttattctgcgagagtgtgcattcatggctgtcaaatgaccccaaaaatattgcagtcata
cattgcatggcaggcaaaggtcgaactggcttaatggtgtgtgcctaccttatttacact
ggcatgttagcagaggaagcatttcagctatatgcccaaaaacgaactaccaacaacgaa
ggagtctctataccaagccaacgtcggtatgtggggtattgggaaaaaatactttctttt
cctacgggagttagcaatggacctccagatgtgaacttgcctcaaccatgtagcagagaa
ttgtggcggattaggctttatgacacagttaacaccacctctgtcttctttgtggtctca
gagctccaagagattcctggtcagttgtaccatccacctgtggaagttgccaagcgttgc
tgtagagaaatcacaaaaggatgtgaggcaaactgcagtcctcgatacttcttgtcattt
gttgaaggggacgaagaagggactacatcagaatcagaacctcgtgtcgttgtccaaatg
gacacagagagtcctgtattataccagaagacctgtcttgactatcatttcagtaaacct
gtgcaagttagtggagatatgcgcatcatattctatcaaaaaatgattggaggccgcctt
ttttatgcctgtttcaatacagccttcattaaaaacagcttgttacagtttaccatccgg
gatttggacaaagttgggagcaaaggcagatcaatttgtggccctgccttctgcgtggag
ttgctatttggtcctgccaacccgaagaattcgatgttatgttcatctgattttgataag
tag

DBGET integrated database retrieval system