KEGG   Durio zibethinus (durian): 111295309Help
Entry
111295309         CDS       T05242                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial-like isoform X1
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00564  Glycerophospholipid metabolism
dzi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    111295309
Enzymes [BR:dzi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     111295309
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 Pyr_redox FAD_binding_3 GIDA Lycopene_cycl NAD_binding_8 HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 111295309
NCBI-ProteinID: XP_022744473
LinkDB All DBs
Position
Unknown
AA seq 631 aa AA seqDB search
MSATATRIRRLAAAAVAVTACGGAILLPPSVSSNDRGGDPAVESVRRMINDQNAVVPSRT
VQESALIGASSANTLDILVVGGGATGCGVALDAATRGLRVGLVEREDFSSGTSSRSTKLI
HGGVRYLEKAVFNLDYGQLKLVFHALEERKQVIENAPHLCHALPCMTPCFDWFEVVYYWM
GLKMYDLVAGRRLLHLSRYYSAQESVELFPTLAREGKDKSLRGTVVYYDGQMNDSRLNVG
LACTAALAGAAVLNHAEVVSFLKDEGTKRIIGARIRDNLSGQEFETYAKVVVNAAGPFCD
SLRKMANKDAQPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRIVFMLPWLGRTLAGTT
DSNTSITPLPEPHEDEIQFILDAICDYLNVKVRRADVLSAWSGIRPLAVDPKAESTESIS
RDHVVSEDYPGLVTITGGKWTTYRSMAEDAVNAAIKSGNLSPRNECITSNLQLIGGDGWE
PSFFTVLAQQYVRMKKSYGGKVVPGVMDTATAKHLSHAYGTLAERVAIIAQNETLGKRLA
HGYPYLEAEVAYCARNEYCESAVDFIARRSRLAFLDTDAAGRALPRVIQILANEHHWDRT
RQKQEMQKAKEFLETFKSSKNAQFHDGKHNS
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaactgccacccgcatccgccgcctcgccgccgcagcagtagcagttaccgca
tgtggtggcgcaatcctcttacctccctctgtatcttccaatgaccgcggcggtgacccc
gccgtagagtccgtgaggcggatgatcaatgaccagaacgccgtcgttccgtcgcgaact
gtccaggaatcggctctgattggtgcgagctcggctaatactctcgatatcctagtcgtt
ggcggcggtgccactggctgcggcgttgctctggacgccgccactagaggcctccgtgtc
ggccttgtcgagcgagaggatttctcgtccggaacgtcttcgcggtccacgaagctaatt
catggaggggtccgctacttggagaaagctgtctttaaccttgactatggacagttgaag
ctggttttccatgcacttgaggagcgtaaacaagttattgagaatgcacctcatctctgc
catgccttgccatgcatgacaccctgttttgattggtttgaggtagtatactactggatg
ggcttgaaaatgtatgatttggtcgcaggacggcgtctgttacatttgtccagatattat
tctgcgcaagaatctgttgagctcttccctactcttgcaagggagggtaaagataaaagc
ttgaggggtacagttgtgtactatgatggacagatgaatgactcacgtctgaatgttgga
ttagcttgcactgctgcactagctggggcggcagtgcttaaccatgcagaagttgtatcc
tttcttaaagatgaaggtaccaagcggataattggtgctagaattcgtgacaatctgtca
ggccaagagttcgaaacctatgcaaaagttgttgtgaatgcggctggaccattttgtgac
tccttaaggaaaatggctaataaggatgcacaacctatgatatgtcctagcagtggtgta
catattgttctccctgattactattctccagaaggaatgggcttgattgtccctaaaact
aaggatggacgcattgttttcatgcttccatggttggggagaactttagctggcactaca
gattctaatacttccatcactccacttccagaaccgcatgaggatgaaattcaatttata
cttgatgccatctgtgattaccttaatgtcaaggtacgacgcgcagatgttctttctgcc
tggagtggtattcgtccgttggcagtggatcctaaagcagagagcactgagagcatctct
agagatcatgttgtttctgaggattatcctggtttggtcacaatcactggtggaaagtgg
actacttatcgaagcatggcagaagatgcagttaatgcagctatcaagtctggcaatctg
agcccaagaaatgaatgtataacaagcaacctacagctgattggtggagatggatgggaa
ccttctttttttactgttcttgctcagcagtatgtacgcatgaagaagtcatatggtggt
aaagttgttcctggggtgatggacacagctactgcaaagcatttgtctcatgcatatggc
accttagcagaacgagtagccatcatagcacagaatgaaactctgggtaagaggcttgct
catgggtacccttatctggaggctgaggttgcatactgtgctcgaaacgaatactgcgaa
tctgctgttgatttcattgctaggagatctcgccttgctttcctggacactgatgcagcg
ggccgtgcgttgccacgcgttatccaaatacttgctaatgagcaccactgggataggaca
agacagaagcaagaaatgcagaaggctaaagaatttttggaaactttcaagtcttcaaag
aatgcacagttccatgatgggaagcacaattcgtga

DBGET integrated database retrieval system