KEGG   Durio zibethinus (durian): 111299714Help
Entry
111299714         CDS       T05242                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2-like isoform X1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00620  Pyruvate metabolism
dzi00710  Carbon fixation in photosynthetic organisms
dzi01100  Metabolic pathways
dzi01200  Carbon metabolism
Module
dzi_M00168  CAM (Crassulacean acid metabolism), dark
dzi_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
dzi_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
dzi_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    111299714
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    111299714
Enzymes [BR:dzi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     111299714
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 111299714
NCBI-ProteinID: XP_022750834
LinkDB All DBs
Position
Unknown
AA seq 965 aa AA seqDB search
MAGRNVEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGQDIRETVQEC
YELSAEYEGKHDPSILEELGKVITSLDPGDSIVVTKSFSHMLSLANLAEEVQIAYRRRIK
LKKGDFADESSATTESDIEETLKRLVGPLKKSPEEVFDSLKNQTVDLVLTAHPTQSVRRS
LLQKHGRIRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRNPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERIPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYFSQIEDLMFELSMWRCSDELRVRADELHRSSRKDAKHYIEFWKQIP
PNEPYRVILGDVRDKLYNTRERARYLLANGISDIPEEATFTNVEQFLEPLELCYRSLCAC
GDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITKHLDIGSYREWTEEHR
QEWLLSELRGKRPLFGPDLPKTEEVADVLDTLHVISELPPDNFGAYIISMATAPSDVLAV
ELLQRECHVKQPLRVVPLFEKLADLEAAPAAVARLFSIDWYRNRISGKQEVMIGYSDSGK
DAGRLSAAWQLYKAQEELVKVAKQFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFTSATLEHGMHPPISPKPEWRALMDEMAVVATK
EYRSVVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGAAFKHVIEKDIKNLHMLQEMYNQWPFFRVTMDLIEMVFAKGDPGIAALYDK
LLVSKELWPFGENLRTNCEDTKRLLLQVAGHRDLLEGDPYLKQRLRLRDAYITTLNVCQA
YTLKRIRDPDYHVKVRPHLSKEYMESTKPAAELVKLNPTSEYAPGLEDTLILTMKGIAAG
MQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtaggaatgtagagaagatggcatcaatagatgcacagctgaggctattggcg
cctgggaaagtctcagaggatgataagttggtggagtatgatgctttgctattggatcgt
tttcttgatattcttcaagatttgcatgggcaggatatcagagaaacggttcaagaatgt
tatgagctttcagcagagtatgagggaaagcatgacccttcgatattggaggagcttggt
aaggtaataacaagtttggatccaggggattcaattgttgttacgaaatcattctcccac
atgctgagcttggccaacttggctgaggaggttcaaattgcttatagaagaaggatcaaa
ttaaagaagggagactttgctgatgaaagttcagcaacaactgaatcagacattgaagag
accctcaagaggcttgtggggccattgaaaaagtcccctgaagaagtttttgattctttg
aagaatcagactgtagatttagtcttaaccgcacatcccactcagtctgttcgaagatct
ttacttcaaaagcatggaaggattcgtaattgtttgactcagttgtatgctaaagacatt
accccagatgataagcaggaacttgatgaggcactacaaagggagattcaagctgctttt
cgtacggatgagatccgaagaaatcctcctaccccacaagatgagatgagagcaggaatg
agctacttccatgagacaatctggaaaggtgtaccaaaattcttgcgccgtgttgacaca
gctttgaagaacatagggataaatgagcgtattccctacaacgcccctcttattcaattc
tcttcgtggatgggaggggatcgtgacggaaaccccagagtaactcctgaagttacaaga
gatgtatgtttattggctagaatgatggctgctaacttgtacttctcccaaatagaggat
cttatgtttgagttatcaatgtggcgctgcagtgatgaacttcgtgttcgtgcagatgaa
cttcatcggtcctcaagaaaagatgcaaagcattacatagaattttggaaacagattcct
ccaaatgagccctatcgtgttattcttggtgatgtgagggacaagctgtacaatacacga
gaacgtgctcgttacctattggccaatgggatttctgacattcctgaagaagcaactttc
accaatgtggagcagtttctggagcctcttgaactctgctatagatcactttgcgcttgt
ggtgatcggccaatagctgatggaagccttcttgatttcttacggcaagtttctaccttt
gggctttcacttgtaagacttgatatccgacaggaatctgacaggcatactgatgttctt
gatgctatcacaaagcacctagacattggatcttatcgagaatggactgaggaacaccga
caggaatggctcttatctgaacttagaggcaaacgccctctatttggccctgatcttccc
aaaacagaagaagtcgctgatgtgttggacacattgcatgtcatttcagaactgcctcca
gataactttggtgcctatataatctcaatggcaacagcaccatctgatgtgcttgccgtt
gagcttttacaacgtgaatgccatgtgaagcaaccattaagggtagttccattgtttgaa
aaacttgcagatcttgaagctgctcctgctgctgtggctcgtcttttctcgatagattgg
tacagaaaccggatcagtggaaaacaagaagtaatgattggttactcagattctggaaag
gatgctggccgtctctctgcagcttggcagttatacaaggctcaagaggaacttgtaaag
gtggcaaaacaattcggtgttaagcttacaatgtttcatggccgaggagggacagttgga
agaggagggggacccacccatcttgctatattgtctcaaccacctgacacaattcatgga
tcacttcgtgtaacagttcaaggtgaagttattgaacagtcatttggagaggagcacttg
tgctttaggacacttcagcgttttacttctgctacacttgagcatggaatgcatccccct
atctctccaaagccagaatggcgtgcacttatggatgaaatggcagtagttgccacaaaa
gaataccgctctgtagtcttccaggaacctcgttttgttgaatacttccgcctagcaaca
ccagaattggagtatggtcggatgaatattggcagtcgtccatcaaaaagaaagccaagt
ggaggcattgaatcactgcgtgcaatcccatggatctttgcatggactcaaacaagattt
catttacctgtgtggcttggctttggggctgcttttaagcatgtcatcgagaaggatatt
aagaatctccacatgcttcaagagatgtacaaccaatggcctttctttagggtcacaatg
gacttaattgaaatggtttttgccaagggagatccaggaattgctgccttatatgacaag
ctcctagtatcaaaggaactctggcctttcggagagaacttgagaactaactgtgaagac
accaagcgtcttcttctccaggttgctggacacagagatcttcttgaaggagatccatac
ctgaaacagaggctccgtcttcgtgatgcttatatcacaacccttaatgtctgccaagca
tacactttgaagaggatccgtgaccctgattatcatgtcaaggtgaggcctcacttatcc
aaggaatacatggaatcaaccaagccggctgcagagcttgtgaaacttaaccctacaagt
gagtatgctcctggtcttgaagacactcttattttgaccatgaaaggtattgctgctggc
atgcaaaacacgggttaa

DBGET integrated database retrieval system