KEGG   Durio zibethinus (durian): 111303513Help
Entry
111303513         CDS       T05242                                 

Definition
(RefSeq) DNA ligase 1-like isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi03030  DNA replication
dzi03410  Base excision repair
dzi03420  Nucleotide excision repair
dzi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    111303513
   03410 Base excision repair
    111303513
   03420 Nucleotide excision repair
    111303513
   03430 Mismatch repair
    111303513
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dzi03032]
    111303513
   03400 DNA repair and recombination proteins [BR:dzi03400]
    111303513
Enzymes [BR:dzi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     111303513
    6.5.1.6  DNA ligase (ATP or NAD+)
     111303513
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     111303513
DNA replication proteins [BR:dzi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    111303513
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     111303513
DNA repair and recombination proteins [BR:dzi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     111303513
   NER (nucleotide excision repair)
    Other NER factors
     111303513
   MMR (mismatch excision repair)
    Other MMR factors
     111303513
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-GeneID: 111303513
NCBI-ProteinID: XP_022755567
LinkDB All DBs
Position
Unknown
AA seq 797 aa AA seqDB search
MLKSRPCHFLRFTCLLPPLFLSSSLAFLPSKSSLFRSKPLSLSSLNPYSNMSSRPSAFDA
LMSNARRLAAKKGPSSSSPTKKRKSIDSSPSPTQNPNPNKTLNSTEVKPDHENASNAIEK
PGKDSPKSKLDETQKPPDSKKIKVVSVSEKNAKLKGKIELLKKKPADFDPKMVACWEKGE
RVPFLFLCLAFDLISSETGRIVITDIVCNMLRTVIDTTPDDLVATVYLAANKVAPAHDGL
ELGIGDASIIKALAEACGRTESQVKSQYKEKGDLGLVAQASRSSQSMMRKPDPLTVVKVF
DTFRLIAKESGKDSQEKKKNRIKALIVAATDCEPQYLIRLLQTKLRIGFSEQTLLAALGQ
AAVYNEQHSKPPLNVQSPLEEAAKIVKQIFSILPVYDKIVPALLTGGVWDLPKTCNFTPG
VPVGPMLAKPTKGVAEIINKFQDMDFVCEYKYDGERAQIHFMENGSVEIYSRNAEWNTGK
FPDVVAAISRFKKSSVKSFVLDCELVAYDRFQRKILPFQILSTRARKNVVVSDIKVDVCV
FAFDILYLNGQPLLQEQLKVRKERLYESFEEEAGFFQFATALTSNDLEEIQAFLNSAVSS
SCEGLIIKTLDRDATYEPSKRSLNWLKLKKDYMESIGDTLDLVPIAAFHGRGKRTGFYGA
FLLACYDDSNEEFQSICKIGTGFTEAELEERSTSLRSKVIPEPKSYYRYSEMIKPDVWFE
ATEVWEVKAADLTISPVHRASIGIVDPDKGISLRFPRLVRIREDKTPEQASSSEQVAEMY
NAQKHNQTNNEDDGDDD
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgctaaagtctcgtccatgccatttccttcgctttacttgtcttcttcctcctctcttt
ctttcctcttccctcgctttcctcccttctaaatcctctctctttcgctccaaacccctc
tctctttcctccttgaacccttactccaacatgtcttctcgcccctccgccttcgatgct
ctcatgtccaacgctcgccgtctagctgctaagaagggcccttcctcttcttcccccacc
aagaaacgcaaatccatcgactcatcgccatctccgacccaaaaccctaatcctaacaaa
accctaaattccaccgaggtcaagcccgaccacgaaaacgctagtaatgcaatcgagaag
cccggtaaagattccccgaagtccaagttagatgagacgcagaaacccccggattcgaag
aaaatcaaggtggtgagtgtctctgaaaaaaatgcgaaattgaaggggaaaattgagtta
ctgaagaagaagccggcggattttgatccaaagatggtggcatgttgggagaaaggagag
agggtgccatttttgtttctgtgcttggcgtttgatttgatatcgagtgagacgggtcgg
attgtgataaccgatattgtttgcaatatgttgaggactgttatagatactacgcctgat
gatttggtggcgacggtttacttggcagcaaataaggttgctccggcacatgatggatta
gagctgggaattggagatgcctccattatcaaggctctcgcagaggcctgtgggaggact
gaatcacaggttaagagtcagtacaaggagaagggagacttgggccttgttgcacaagct
agccgttcatctcaatcaatgatgcgcaagcctgatccattaactgttgtcaaagtgttt
gacacgtttcggctaattgctaaggaatctggaaaggatagtcaggagaagaaaaaaaat
cgtatcaaggcacttattgttgccgcaactgactgcgaacctcaatatttgattcgtcta
cttcagacaaagttgcgaattggattttcagagcagactctgttagctgcattaggacag
gctgctgtatataatgaacaacattctaaaccacctctgaacgttcagtctcctttagaa
gaggctgctaagattgtcaaacaaattttttctatccttccagtctatgataaaatagtc
cctgcccttttgactggtggtgtatgggatcttccaaaaacctgtaactttacgcctggt
gtccctgttggacctatgctagcaaaaccaaccaaaggggttgctgaaattataaataag
ttccaggatatggactttgtatgtgaatataagtatgatggagaacgtgcacagatacat
ttcatggagaatggttcagttgagatatacagtcgaaatgctgagtggaacactggaaag
tttcctgatgttgttgctgcaatttctagattcaagaagtcctctgtaaaatcatttgtt
ttggattgtgagctggttgcttatgatcggtttcaaaggaaaattttaccctttcagatc
cttagtacaagagctcgaaaaaatgttgtagtgagtgacatcaaagttgatgtgtgcgta
tttgcttttgacatcctgtatcttaatgggcaaccacttcttcaagaacaactgaaagtt
cgtaaagagaggctttatgaatcatttgaagaagaagctgggttttttcagtttgccaca
gccttaacatcaaatgatcttgaggaaatacaagctttccttaattctgctgtttcttca
agttgtgagggtttaattatcaaaacattggatagagatgctacatatgaaccatcaaag
cggtcactcaactggctaaaattgaagaaagactacatggaaagtattggagacacatta
gaccttgtgcctattgctgctttccatggccgtgggaagcggactggattctatggtgcc
tttctcttggcatgttatgatgacagtaatgaagaattccagagtatctgtaaaataggt
actggatttactgaagcagagcttgaagaacgttccaccagtctccgctctaaagtgatt
cctgaaccaaagtcatactatcgttattcagagatgatcaagccagatgtgtggtttgag
gctactgaggtttgggaggtaaaggctgcagacttgactatcagtcctgttcatcgtgct
tcaattgggattgtggatcctgataagggcatatctcttcgatttccacgtttagttcgc
attcgagaagataagactccagagcaagcttcatcatctgagcaggttgctgagatgtat
aatgctcaaaaacacaatcagactaacaatgaagatgatggtgacgatgattga

DBGET integrated database retrieval system