KEGG   Durio zibethinus (durian): 111304351Help
Entry
111304351         CDS       T05242                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111304351
Enzymes [BR:dzi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     111304351
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 111304351
NCBI-ProteinID: XP_022756630
LinkDB All DBs
Position
Unknown
AA seq 222 aa AA seqDB search
MQAAAIAAMAAHAILTTIPSHHTLLSPPPTNPSNPPVLHSSFRGVSLKLPRQSLSIAATV
PKKPFSLFAAKKAVAVLKGDSKVEGVVTLTQEDDGPTTVNVRVTGLTPGPHGFHLHEYGD
TTNGCMSTGAHFNPNKMTHGAPEDEVRHAGDLGNILANADGMAEATIVDKQIPLSGPNAV
IGRAFVVHELEDDLGKGGHELSLTTGNAGGRLACGVVGLTPI
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctgcggcaatagcagccatggcagcccacgcaattctcacgacaatcccatca
caccacactctcctttctccacccccaactaacccttctaacccaccagttcttcactcc
tcatttcgtggtgtctctctcaagctccctcgtcaatccctctccattgctgccactgtc
cccaagaagccattttctcttttcgctgccaagaaagcagtggctgtgcttaaaggtgat
tccaaagttgaaggcgttgtcactttgactcaagaagatgatggtcctacaactgtgaat
gttcgtgttaccggtcttactccagggcctcatgggttccacctgcatgagtatggtgac
acaacaaatggatgcatgtcaacaggagcacatttcaatcctaacaaaatgacacatggt
gctcctgaggacgaagtacgccatgcgggtgacctgggaaacatattggctaatgctgat
ggaatggcagaggcaacaattgtagacaagcagataccactaagcggccccaatgcagtc
attggaagagcatttgtggttcatgagcttgaggatgatcttggaaagggtggacatgaa
cttagtctcaccactggcaatgcaggaggaagattggcatgtggtgttgttggcttgact
ccgatataa

DBGET integrated database retrieval system