KEGG   Durio zibethinus (durian): 111310051Help
Entry
111310051         CDS       T05242                                 

Definition
(RefSeq) serine/threonine-protein kinase AtPK2/AtPK19-like
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
dzi  Durio zibethinus (durian)
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dzi01001]
    111310051
Enzymes [BR:dzi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111310051
Protein kinases [BR:dzi01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   111310051
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo Pkinase_C APH FTA2 Haspin_kinase RIO1
Motif
Other DBs
NCBI-GeneID: 111310051
NCBI-ProteinID: XP_022764882
LinkDB All DBs
Position
Unknown
AA seq 486 aa AA seqDB search
MVSSHLSSLNESRMHKAFQNQLLFPTGQPDTLTSDHLEFDFSDVFGPAPVQASMEISTEN
PKNLVVATESNELLYDDPAVICSRSHSLVGPSTYFSHSLKLSKLTFRETGDSLELVEGVR
ERTQKEFRKYSIDDVILENPDGHIESHPFECQSVGLEDFEVLKVVGQGAFGKVYQVRRSD
TSDIYAMKVMRKDKIMEKNHAEYMKSERDILTKVDHPFIVQLRYSFQTKYRLYLVLDFVN
GGHLFFQLYRQGLFREDLARIYTAEIVSAVSHLHANGIMHRDLKPENILLDADGHVMLTD
FGLAKEFDENTRSNSMCGTLEYMSPEIVLGKGHDKAADWWSVGILLYEMLTGKPPFTGGN
RQKIQEKIIKDKIKLPAFLSSEAHSILKGLLQKEASKRLGSGQGGSEEIKRHKWFKSINW
KKLESREMRPSFLPEVAGKHCVANFEECWTNMPVLDSPVASPTFGDNPFKGFTYVRPAAS
FLQRNA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggtttcctctcacttatctagtttaaatgagtcccgcatgcacaaagcctttcagaat
cagttgctttttcccacagggcaacctgatactctgacctctgatcatcttgagtttgat
ttctctgatgtgttcggacctgctccagttcaagcctcaatggaaatcagcactgaaaat
cctaaaaatctggttgttgcaactgagtcaaatgaattgctttatgacgatccagctgtc
atctgtagccgctcacattccttggttggcccctcaacttattttagccactcattgaag
cttagcaagcttacatttcgtgaaacaggggattccttggaacttgtagaaggagtcagg
gaaaggactcaaaaagagtttcggaaatattcaattgatgatgttattcttgagaaccct
gatggccatatagagagtcatccttttgaatgccagtctgtgggacttgaagattttgaa
gttttaaaggttgttggccaaggtgcttttggaaaggtgtatcaagtaaggaggagtgat
acctcagacatatatgcaatgaaagtcatgcgcaaggataagattatggagaaaaatcac
gccgaatacatgaaatctgagagagatatattaacaaaagtggatcaccccttcattgtg
cagctcagatactcattccaaaccaaatataggctgtaccttgtgcttgactttgttaat
gggggacatcttttcttccagctttatcgccagggcttgttcagggaagatttggctcgc
atatataccgcagagatagtatcagctgtttctcatctccatgcaaatggcataatgcac
agggatctcaaacctgaaaatattcttctagatgcagatggacatgttatgctgactgat
tttggcctggcaaaggaatttgacgaaaatacgagatccaattccatgtgtggaacttta
gaatatatgtcacctgaaattgttcttgggaaaggccatgacaaggctgctgattggtgg
agtgtgggaattctactgtatgaaatgcttactgggaagccaccctttaccggtggaaac
agacagaagatccaggagaaaataataaaggataagatcaagctgccagcatttttgtca
agtgaagcgcactcgatcctcaaggggctgctgcagaaagaagcaagtaagcgtcttggc
agtggacaaggtggtagtgaggagatcaaacgccataagtggttcaagtccattaactgg
aagaaattagagtctcgggagatgaggccaagttttctccctgaagttgcagggaagcac
tgtgttgctaattttgaggagtgctggactaacatgccagttcttgattctccagttgct
agtccaacattcggtgacaatccctttaaggggttcacatatgtgaggcctgcagcctca
tttcttcagagaaatgcttga

DBGET integrated database retrieval system