KEGG   Durio zibethinus (durian): 111311569Help
Entry
111311569         CDS       T05242                                 

Definition
(RefSeq) enoyl-[acyl-carrier-protein] reductase [NADH], chloroplastic-like
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00061  Fatty acid biosynthesis
dzi00780  Biotin metabolism
dzi01100  Metabolic pathways
dzi01212  Fatty acid metabolism
Module
dzi_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    111311569
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    111311569
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    111311569
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dzi01004]
    111311569
Enzymes [BR:dzi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     111311569
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     111311569
Lipid biosynthesis proteins [BR:dzi01004]
 Fatty acid synthase
  Component type
   111311569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 111311569
NCBI-ProteinID: XP_022766791
LinkDB All DBs
Position
Unknown
AA seq 393 aa AA seqDB search
MVTAAAPGTYMATIKTCISSSSSRKMLVSGAMNISTEHKEAPWTRLASSSHISSRQPFLQ
RITSGPVKFEKFVTRAMSETNDNKPLPGLPVDLRGKRAFIAGVADDNGYGWAIAKSLAAA
GAEILVGTWVPALNIFESSLRRGKFDESRILPDGSLMEITKVYPMDAVYDCPEDVPEDVK
TNKRYSGSSNWTVQELVESVKKDFGSIDILVHSLANGPEVSKPLLETSRNGYLAALSASS
YSFISILKHFLPIMNPGGASISLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRK
HKVRVNTISAGPLRSRAAKAIGFIDMMIDYSLANAPLQKELSAEEVGNAAAFLASPLASA
VTGAVVYVDNGLNAMGVGVDSPIFANLDIPKDN
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggtaacagctgcagctcctggcacgtacatggccactattaagacttgtatttcttct
tcttcttctcgtaaaatgcttgtctcaggtgccatgaacatcagcactgagcataaagag
gcaccctggacaaggcttgcaagctcctctcacatctcatcaaggcagccattcctccag
aggattacatcaggacccgtgaaatttgaaaagtttgttacgagagctatgtctgagaca
aatgacaacaaacctttgccaggactgcctgttgatttgcgaggtaaaagagcatttata
gctggtgttgctgatgacaatggatatggttgggcaatagcaaaatctcttgctgctgct
ggagctgaaattcttgttgggacgtgggtgcctgcactcaacatatttgagagcagtcta
agacgtgggaaatttgacgaatcacgcatattgccggatggatcgttaatggaaatcaca
aaagtttatccaatggatgctgtttatgactgtcctgaggatgttcctgaagatgtcaaa
acaaataaacgctattcagggtcttcaaattggacggttcaggagcttgttgaatctgtg
aaaaaggattttggtagtattgacattcttgttcactcacttgcaaatggaccagaggta
agcaaaccacttctagagacatcaagaaatggatatcttgctgccctatctgcatcaagt
tactcttttatttctatactcaaacactttcttccaataatgaatccaggaggtgcttcg
atttctctaacatacattgcttctgaaagaataatcccaggatatggtggaggcatgagt
tcagctaaggctgctttggagagtgatacacgtgtgctggcttttgaagcaggaagaaaa
cacaaagtcagagtcaacacaatatctgcaggcccattgaggagtagagctgcgaaagca
attggattcattgacatgatgatcgattactcgctggctaatgcacccctacagaaagaa
ctatcagcagaggaagtgggaaatgctgctgcctttctggcgtccccgttggcttcagct
gtcactggagctgttgtctacgttgataatggtctaaatgcaatgggagtgggagttgac
agtccaatatttgcgaatcttgacattccaaaagataactga

DBGET integrated database retrieval system