KEGG   Durio zibethinus (durian): 111311949Help
Entry
111311949         CDS       T05242                                 

Definition
(RefSeq) ribonuclease II, chloroplastic/mitochondrial
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
dzi  Durio zibethinus (durian)
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dzi03016]
    111311949
Enzymes [BR:dzi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     111311949
Transfer RNA biogenesis [BR:dzi03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    111311949
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNB PTPS
Motif
Other DBs
NCBI-GeneID: 111311949
NCBI-ProteinID: XP_022767553
LinkDB All DBs
Position
Unknown
AA seq 795 aa AA seqDB search
MMAVRAVNGGSLFRSAASPPLLTFCCRLRHFGSLQFRRNSELGLRFPIFSCENQFLGYGG
GRSRSAHSLVDCVMEELADWRCRRRVRANVKVRLTSSSELLEDKLVNRELEKGLLLEFKK
DSDRVLLGVAQRPDGKKNWMVYDQNGVTSSIKPQQITYIVPGVENFDQTEISKFLREAQE
NLDPTLLEIAWVELLEKNKSVTAEELAEMIFGSSEPLESYCAHLLLSKDEVYFSVLETKG
FRSIYGPRPTGQVEELLRKKLAKDAAEKELQDFVQLLLSAKAKPAHAKPPKSSWMVDEKI
QYKIESLEAYAIDAWKSDEQRKTAGLILKAMGLTKSASSALNLLINIGYFPVHVNLDLLK
LNILTNHSGEIIAAAESLLSDSSDPDEMNRKDLTHLKVYAIDVDEADELDDALSATRLQD
GRIRVWIHVADPIRYVEPGSTVDREALRRGTSVFLPTGTYPMFPEKLAMEGMSLKQGEHC
NAVSVSVVLHSDGSIAEYSVQSSIIKPTYMLTYESATELLHLNLEEEAELKILSEAAALR
LKWRCRQGAIDTSTLETRIKVVNPEDPEPSINLYIENQADPAMRLVSELMILCGEVVATF
GSCNNIPLPYRGQPQSNIDVSVYSHLPEGPVRSSAIVRIMRAAEIDFRKPIRHGVLGIPG
YVQFTSPIRRYLDLLAHFQVKAFLRGESPPFSAGQLEGMASIVNMQVRVVRRLSSSSLRY
WIIEFLRRQPREKIYRALILRFIKDRIAALLLVEVGLQASAWVSVGAQVGDEVDVKVEEA
HPRDDVLSLKEVIRN
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgatggctgttcgcgccgtcaacggaggttctttgtttcgttccgccgcatcacctcct
ctcttgacgttctgctgccggcttcgccactttggctccttacagtttcgccgcaactct
gaattagggcttcggtttcctatcttcagttgcgagaatcagtttttaggttatggcggt
ggccgttcacgttcggctcatagtctcgtcgattgcgtcatggaagagctagcagattgg
cgctgtcgcagaagagttcgcgccaatgtcaaggtgaggctaacgagtagcagtgagctt
cttgaggataagcttgtaaatcgagaattagaaaaggggttgctgctggagtttaagaag
gattcggatagggtattgcttggagttgctcagagacctgatggcaagaaaaattggatg
gtgtacgatcagaatggtgtcacatcatccatcaaaccgcagcaaattacatatattgtt
ccaggtgtagaaaattttgatcagacagaaatttcaaaatttctccgagaagctcaggaa
aacttggatccaacattactagaaattgcttgggttgagcttcttgaaaagaacaagtca
gtgacagcagaagaattagcagagatgatttttggtagttcggagcctcttgagagctac
tgcgcccatcttttgctatcaaaagatgaagtatactttagtgtgttggagacaaaaggt
tttcgttccatttatgggcctcgaccaacaggacaggtggaagaacttttacgcaagaag
cttgccaaggatgctgctgagaaagaacttcaggacttcgtacaattacttctgtctgct
aaagcaaagcctgcacatgctaaacctcccaaatcttcatggatggtggatgagaaaatc
caatacaaaattgagtctcttgaagcatatgccattgatgcttggaaaagtgatgagcaa
aggaaaactgctggactgatccttaaggcaatgggacttacaaaatcagcatcctcagca
ctaaacctactcataaatattggttattttcctgtacatgtcaatctggacctgttaaag
ttaaacattcttacaaaccattctggtgagattatagctgctgctgaaagtcttttgtct
gattcatctgacccagatgagatgaacagaaaggatcttactcatttgaaggtttatgct
attgatgttgatgaggctgacgagcttgatgatgccttgagtgcaacaaggttgcaagat
ggccgcattagagtatggatacatgttgcagatccaattagatatgttgaacctgggagc
acagtagacagggaagcactgagaagaggaacttctgttttcttgccaactggcacttat
cctatgtttcctgagaaacttgccatggagggaatgagtttgaaacaaggagaacattgc
aatgctgtcagtgtatctgttgtcttgcactctgatggcagcattgcagagtattcagtt
caaagctcaatcattaaaccaacttatatgctgacctatgagagtgcaactgagctgctt
catttgaacttggaagaggaggctgagctgaagattctgtctgaggcagccgctctaagg
ttaaaatggcgttgccggcagggtgcaattgatacatccaccctagaaactcgaattaaa
gtggttaacccagaggacccagaaccatcgattaatctttacattgaaaaccaggcagac
cctgcaatgcgacttgtttctgagctcatgatactatgtggagaagttgtagcaactttt
ggctcttgcaataacattcctttaccctatagaggtcaaccgcagtcaaatattgatgta
tctgtgtattcacatcttcctgaaggaccagttcgaagctctgccattgttagaataatg
cgggcagctgaaattgatttcaggaagcctattcgacatggggttctgggaattcctggt
tatgttcagtttacatcacccatccgtagatatttggatcttcttgctcattttcaggta
aaggcatttcttagaggtgaatctccacctttttcagctggtcagctagaagggatggca
tcaatagtaaatatgcaagttagagtagtaaggaggctctccagcagcagtctccggtat
tggataatagaatttctgagaaggcagccaagggagaaaatatatcgtgcattgatcctt
cgattcatcaaggacaggattgcagcgttgttactagttgaggtgggacttcaggcatct
gcatgggtgtctgtaggagcacaggtaggagatgaagtagacgttaaagtggaagaagcc
catcctcgtgatgatgttctttcccttaaggaggttattagaaactga

DBGET integrated database retrieval system