KEGG   Durio zibethinus (durian): 111317858Help
Entry
111317858         CDS       T05242                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00010  Glycolysis / Gluconeogenesis
dzi00053  Ascorbate and aldarate metabolism
dzi00071  Fatty acid degradation
dzi00280  Valine, leucine and isoleucine degradation
dzi00310  Lysine degradation
dzi00330  Arginine and proline metabolism
dzi00340  Histidine metabolism
dzi00380  Tryptophan metabolism
dzi00410  beta-Alanine metabolism
dzi00561  Glycerolipid metabolism
dzi00620  Pyruvate metabolism
dzi00903  Limonene and pinene degradation
dzi01100  Metabolic pathways
dzi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111317858
   00053 Ascorbate and aldarate metabolism
    111317858
   00620 Pyruvate metabolism
    111317858
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111317858
   00561 Glycerolipid metabolism
    111317858
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    111317858
   00310 Lysine degradation
    111317858
   00330 Arginine and proline metabolism
    111317858
   00340 Histidine metabolism
    111317858
   00380 Tryptophan metabolism
    111317858
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    111317858
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    111317858
Enzymes [BR:dzi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     111317858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 111317858
NCBI-ProteinID: XP_022776072
LinkDB All DBs
Position
Unknown
AA seq 537 aa AA seqDB search
MAGATWISSLLSRKLASSSSSLLSKGRISGVGRVVSNYTTAAAFENPITPSVKVNYTQLL
INGNFVDSASGRTFPTHDPRTGDVIAHVAEADAEDINRAVSAARKAFDEGTWPKMTAYER
SRVLFRFADLLDKHTEELATLETWDNGKPYEQAAKVELPMISRIIRYYAGWADKIHGLTV
PADGPHHVQTIHEPIGVAGQIIPWNFPLLMFAWKIGPALACGNTIVLKTAEQTPLSALYA
AKLIHEAGLPPGVLNVVSGFGPTAGAALASHMEVDKLAFTGSTQTGKIVLELAAKSNLKP
VTLELGGKSPFIVCKDADVDKAVELAHFALFFNQGQCCCAGSRTYVHESVYDEFLEKAKT
RALKRSVGDPFLAGIEQGPQIDSEQFEKILRYIRSGVESGATLETGGERIGDKGYYIQPT
VFSNVKEDMLIAKDEIFGPVQSVLKFKDIDEVIGRANATSYGLAAGVFTHDLDTANTLTR
ALKVGTVWINCYDVFDAAIPFGGYKMSGQGREKGIHCLSNYLQVKAVVTPLKDPAWI
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggctacctggatttcatcgttgctttctcgtaaattggcttcttcttcttct
tctctgctctctaaagggaggatctctggagtgggcagagtggtttctaattacaccact
gctgctgcttttgagaacccaattactccttctgtcaaagtgaactacactcagctttta
attaatgggaactttgttgattcggcatcaggtagaacttttccaacacatgaccccagg
acaggggatgtgattgctcatgttgctgaagctgatgctgaagatataaatcgagcagtt
tctgctgctcgcaaggcctttgatgaaggaacatggccaaagatgactgcttatgaaaga
tcgagggtattgttccgatttgctgatcttcttgacaaacatactgaggaacttgcgaca
cttgagacttgggataatggaaagccatatgaacaggctgctaaggttgaactaccgatg
atctcacgtataattcggtactatgctggttgggcagacaagattcatggtcttacagtt
ccagctgatggcccacatcatgtgcaaaccatacatgaaccaattggtgttgctggtcaa
attattccatggaattttcctcttctcatgtttgcttggaagattggacctgccttagca
tgtggcaatactatcgttcttaagacagcagagcagacacccttgtctgctctttatgct
gccaagctaattcacgaggctggacttcctccaggtgttctaaatgtggtttcaggtttt
ggtccaactgctggtgctgctcttgccagtcatatggaagtggataagcttgctttcact
ggatcaactcaaactggaaaaattgtccttgagttggctgcgaaaagcaatcttaagccc
gtaacattggagcttggaggaaaatcgccttttattgtatgcaaggatgctgatgtggac
aaggcagttgagctggcccactttgctttgttctttaatcagggacaatgttgctgtgct
ggctctcgtacatatgtacatgagagtgtatatgatgaatttttagagaaggcaaagaca
cgtgcattgaaacgtagtgttggtgatccattcttggctggaattgaacaaggtcctcag
attgattcagaacaatttgaaaagatcttgaggtacataagatcgggtgttgaaagtgga
gcaactcttgaaaccggaggggagaggataggggacaagggctactatattcagcccacc
gtcttctccaacgtaaaggaagacatgttgattgctaaggatgagatatttggtccagtt
cagtctgtcctaaaattcaaggacatcgatgaggttattgggagggctaatgctaccagt
tatggactggctgctggtgtctttacacatgacttagacactgcaaacaccttgacccgc
gcattgaaagtgggaacagtttggataaactgctatgatgtgtttgatgcagctattcca
tttggtgggtacaagatgagtggacagggaagagaaaagggtattcattgtctaagcaat
tacttgcaagtaaaggccgttgtcactcccttgaaggatccagcatggatataa

DBGET integrated database retrieval system