KEGG   Durio zibethinus (durian): 111318129Help
Entry
111318129         CDS       T05242                                 

Definition
(RefSeq) glutamate decarboxylase 4-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00250  Alanine, aspartate and glutamate metabolism
dzi00410  beta-Alanine metabolism
dzi00430  Taurine and hypotaurine metabolism
dzi00650  Butanoate metabolism
dzi01100  Metabolic pathways
dzi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    111318129
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    111318129
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    111318129
   00430 Taurine and hypotaurine metabolism
    111318129
Enzymes [BR:dzi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     111318129
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 111318129
NCBI-ProteinID: XP_022776532
LinkDB All DBs
Position
Unknown
AA seq 498 aa AA seqDB search
MVLSKIASQTDVSIHSTFASRYVRNSLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMDAINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDSEAAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLREGYYVMDPAQAVEMVDENTICVAAILGSTLNGEFEDVKLLNDLLVEKNKETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGCEGYRNVMENCHENAMVLKEGLEK
TGRFNIVSKDNGVPLVAFSLKDNKRHDEFEISEMLRRYGWIVPAYTMPADAQHITVLRVV
IREDFSRTLAERLVLDIQKVLHELDTLPAKVNAKLAVAVEENGKNGTVKKTALETQREIT
AYWKKYVSDRKINQTQIC
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggtgctatctaagatagcttctcaaactgatgtctcaattcactctacttttgcctct
cgatatgtccgaaactcacttcccaggttcaagatgccagagaactcaataccaaaagag
gctgcatatcagatcatcaacgatgagctgatgcttgatgggaacccaaggttgaacctt
gcctcttttgttactacctggatggagcctgaatgtgataagcttataatggatgccatt
aacaagaactacgttgacatggatgagtaccctgtcaccactgagcttcagaaccgttgt
gtgaacatgatagcacatctcttcaatgcaccacttggagactccgaggccgctgttgga
gtgggaacagttgggtcatccgaggcaatcatgttggctggccttgctttcaagagaaag
tggcaaaacaagcgtaaggctgaaggcaaaccctatgacaaacccaatatcgtgactgga
gccaatgttcaggtgtgctgggagaaatttgcaaggtactttgaagtagaattgaaggaa
gtgaagctgagggaaggatactatgtgatggaccctgcccaagctgtggaaatggtagat
gaaaacaccatctgtgtagctgctatattgggttccaccctcaatggagaatttgaagat
gtcaagcttctaaatgatctcttggtagaaaagaacaaggaaactggatgggatacccca
attcatgttgatgcagctagtggtgggtttattgcaccattcttgtacccagaacttgag
tgggacttcaggcttcccctcgtgaagagcattaatgttagtggccataaatatggtctt
gtctatgctggcattggttgggttatctggaggagcaaggaagacttgcctgaagaactt
atttttcacatcaactaccttggagctgatcaacccactttcactctcaatttctccaaa
ggttctagccaagttattgctcagtactaccaactaatccgtttgggatgtgagggatac
agaaatgtcatggagaactgtcatgaaaacgctatggtcctgaaagaaggattggagaaa
acagggcgctttaacattgtgtcaaaggacaatggggttcctctggtggccttttctctc
aaggacaacaagcgccatgatgagttcgagatatctgagatgttgcgccggtatggttgg
attgtgcctgcctacaccatgccagcagatgctcagcatatcactgtgctccgtgttgtc
atcagggaagacttctcccgcaccttagctgagcgccttgtgcttgacatccaaaaggtg
ctccatgagctggatacgctccctgcaaaggtcaatgccaaactggctgtggctgtagaa
gagaatggcaaaaatggcacagttaagaagactgcccttgagacccagagggaaatcact
gcttactggaagaaatatgtcagtgacagaaaaattaaccaaacccaaatttgttag

DBGET integrated database retrieval system