KEGG   Durio zibethinus (durian): 111318387Help
Entry
111318387         CDS       T05242                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic isoform X1
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00010  Glycolysis / Gluconeogenesis
dzi00020  Citrate cycle (TCA cycle)
dzi00620  Pyruvate metabolism
dzi01100  Metabolic pathways
dzi01110  Biosynthesis of secondary metabolites
dzi01200  Carbon metabolism
Module
dzi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111318387
   00020 Citrate cycle (TCA cycle)
    111318387
   00620 Pyruvate metabolism
    111318387
Enzymes [BR:dzi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     111318387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 111318387
NCBI-ProteinID: XP_022776962
LinkDB All DBs
Position
Unknown
AA seq 480 aa AA seqDB search
MASPFLSNTTISFSSSLSSSSLPRLVPSISSSPIRFKSTPRRILTVRSKIREIFMPALSS
TMTEGKIVSWIKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVGEGETAPVGAA
IGILAETEDEVAEAKAKAASKTGAATPSAPPATPSPAPAPPKPTPAPAAAPVAEGPRKTV
ATPYAKKLAKQHKVDIESVVGTGPFGRITPEDIEAAAGISPSKTNVGPAVVAEAKPAAPL
KATAAAAAPSSLPPPVPGSTVVPFTTMQAAVSKNMVESLSVPTFRVGYPVTTDALDALYE
KVKPKGVTMTALLAKATAMALVQHPVVNASCKDGKSFTYNSNINIAVAVAINGGLITPVL
QDADKLDLYLLSQKWKELVEKARSKQLQPQEYSTGTFTLSNLGMFGVDRFDAILPPGQGA
IMAVGASKPTVVADADGFFSVKNKMLVNVTADHRIIYGADLAAFLRTFSKIVENPESLTL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcttctccttttctctccaacaccaccatatctttctcctcttccctctcttcttct
tctcttcctcgtcttgtgccatctatttcttcctctccaattcgtttcaagtcaacccca
agacgaatcttgactgtccgatcgaagatcagggagatcttcatgcccgccctcagttcc
accatgaccgagggcaagatcgtgtcttggattaaatccgaaggcgatgttctctccaaa
ggtgaaagcgtcgtcgttgttgaatccgacaaagctgacatggacgtcgagactttctat
gacggcattctcgctgctatcgttgttggggaaggcgaaactgcccctgtcggtgccgcc
attggcatcctcgctgagactgaagatgaagttgccgaggctaaagccaaagctgcctca
aaaacgggtgctgcaaccccatctgctcctcctgctactccttctccagctccagctccc
ccgaagccaacgccagctccagcggctgcgccagttgcggaggggccgaggaaaaccgtt
gcgacaccatatgcaaagaagttagcgaagcagcacaaggtggatattgagtccgtggtg
ggaacagggccgtttgggaggatcacgcccgaggacattgaggcggccgccggtatttcg
ccttccaagacaaatgttggacctgcggtggttgcggaagctaagcctgctgctccactg
aaagctacagctgctgctgctgccccttctagccttcctcctccagttccaggttctaca
gtagtgccatttacgacaatgcaggctgccgtttcgaagaatatggtggagagtctttca
gtgcccacatttcgagtggggtatcctgtgactacggatgcgcttgatgccttgtatgag
aaggtgaaaccaaagggtgtgacaatgactgctctgttagcgaaagctactgcaatggca
ctggtgcagcaccctgttgtgaatgcaagctgtaaagatggcaagagttttacttataat
agtaacattaacattgcggtagctgttgctatcaatggtggcttgattaccccagttctt
caggatgcagataagttggatttgtatctattgtctcaaaaatggaaagagctggtggag
aaagccagatcaaagcagcttcagcctcaagaatatagtacagggacatttactctgtcc
aatctgggcatgttcggtgtggacaggtttgatgccattcttcccccaggccagggagct
atcatggctgttggagcatcaaagccaactgttgttgctgatgctgatggattcttcagt
gtgaaaaacaaaatgctggtgaatgtaactgctgatcaccgcattatctatggtgctgat
ttggctgccttccttcggaccttctcaaagattgttgagaaccctgaaagcctgactttg
tag

DBGET integrated database retrieval system