KEGG   Endosymbiont of Acanthamoeba sp. UWC8: I862_02865Help
Entry
I862_02865        CDS       T03255                                 

Definition
(GenBank) bifunctional malic enzyme oxidoreductase/phosphotransacetylase
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
eaa  Endosymbiont of Acanthamoeba sp. UWC8
Pathway
eaa00620  Pyruvate metabolism
eaa01100  Metabolic pathways
eaa01120  Microbial metabolism in diverse environments
eaa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    I862_02865
Enzymes [BR:eaa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     I862_02865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: AIF81136
UniProt: A0A075MI65
LinkDB All DBs
Position
complement(589292..591580)
Genome map
AA seq 762 aa AA seqDB search
MSAKNDNDYKVSIYNEALKFHAEGKKGKLGIDPLKPLTNQRDLSLAYSPGVAAPCLEIHN
DPAKAFEYTSKGNFVAVISNGTAVLGLGNLGALASKPVMEGKAVLFKRFADIDAIDLEVS
TEDPEEFINSIKYLGASWGGINLEDIKAPECFIIESKLKELMDIPVFHDDQHGTAIITAA
GLINAAHLTGREFKDLKVVVNGAGSAGIACIELLKNMGLPHENAILCDTSGVIYEGRTNG
MNQWKAAHAVDTPHRTLAEAMVGADVFLGLSAKGALTKEMVRVMAENPIIFAMANPDPEI
TPEEVREVRGDAIVATGRSDYDNQVNNVMGFPYIFRGALDVQATTINDEMKIAAAKAIAM
LAREEVPAEVSAAYGGKKLKYGASYIIPVPFDSRLIHVVSMAVAEAAMRTGVARKPIEDF
YAYKNQLAARLNPSINMMNFFFERLRASPKTILFTEGDEEAMIRAAIEWRNLGYGKAVLV
GYEEAINHTLSKLEVGSLSDIEIINAVHHPDYEKLVDYLYGKLQRKGYLYKDCENLLRRE
RNVFASLLVELGYNDGMVTGLTKSYLSCVDDITKAVEVKQGNLLFGLSIMIAKNRTIFIA
DTTINEIPDSNELAEIAIHAAEEARSMGHDPRVAFISFSNFGNPMREKAQRIRDAVTLLD
KRNVDFEYDGEMQASVALNAELLKLYPFCRLSQPANILIMPALHSANIASKLLQELGGGK
LIGPVLCGIKKSIQIVQMGSTESDVLNMAAMAAYRNSDFADK
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccaaaaatgataatgattataaggttagtatttataacgaagccttgaaattt
catgctgagggcaaaaaaggaaaattaggaatagatcctttaaaaccgcttactaatcaa
agggatttatcattagcatattcacctggtgtggctgcgccttgccttgaaattcataat
gatcctgctaaagcttttgaatatacttcaaaaggtaattttgttgcagttatttctaac
ggaaccgctgttttaggcttaggtaatcttggtgcgctcgcatccaagccggtaatggaa
ggaaaagcagtattgtttaaaaggtttgctgacattgatgctattgatttagaagtgtct
acggaagatcccgaagaattcattaattcaattaaatatttaggcgcaagttggggaggg
attaatctagaagatattaaagccccggaatgttttatcattgaaagcaaactaaaagaa
ttaatggatattcccgtattccatgacgatcaacacggtactgcaattattaccgccgca
gggctaattaatgcagcccacctcacgggtagagaatttaaagacttaaaggtagtagta
aacggtgcaggttcagcaggtattgcttgtatcgaattattaaaaaatatgggattgccg
catgaaaatgctatcttatgtgatacgtctggagtaatttatgagggcagaactaacggg
atgaaccaatggaaagctgcccatgcggtcgatactccgcatagaactttagccgaagct
atggttggagcagatgtattcttaggcttgtcggctaaaggtgctttgactaaagagatg
gttagggtaatggcggaaaacccgattatatttgcaatggcgaatcctgacccggaaatt
acacccgaagaagtaagagaagttaggggtgacgctattgttgcaacaggaagatccgac
tacgataaccaagtgaataatgtaatgggcttcccttatatatttaggggcgcgcttgac
gttcaggctacaaccattaatgatgagatgaaaatagctgccgcaaaagcaattgcaatg
ctcgccagggaagaggtgccggcagaggtttcagcagcttatggaggcaaaaagttaaag
tacggagcaagctatataatcccggttccgtttgattccaggcttatccatgtggtttca
atggcagttgccgaagccgctatgcgaacaggtgttgcgcgtaaaccgatagaagatttt
tatgcatataaaaatcaattggctgcaagactcaacccttcaattaatatgatgaacttc
ttctttgagcgcttaagagcgagccctaaaaccatcctatttaccgaaggcgatgaagaa
gcgatgatcagggctgcaatagagtggcgcaatttaggttatggaaaggctgttttagtc
ggttatgaagaggcgattaaccacaccttaagtaagcttgaagtcggaagtttaagtgat
atagaaattatcaatgccgttcatcatcccgactatgaaaaattagtagattacctatac
ggtaagttgcaaagaaaaggttacctatataaagactgtgagaatttactaagaagagag
cgaaatgttttcgcctcacttttagttgagctcggttataatgacgggatggtgacaggg
ttgactaagagttacttatcttgcgttgatgacatcactaaagcagttgaagttaagcag
ggaaatttattgttcggactttccatcatgattgcgaaaaaccgaaccatttttattgca
gatactacaattaatgaaatcccggattctaacgagttagccgaaattgccatccatgcg
gcagaagaggcaaggtctatggggcatgatccgagagttgcatttatttccttctcaaat
ttcgggaaccctatgcgagaaaaagctcaaagaataagagatgccgttaccttacttgat
aagcgcaatgttgattttgaatatgacggtgaaatgcaggcaagtgttgcattaaatgct
gagctattaaaactatatccgttttgcaggttatctcaaccggctaatattttaataatg
ccggcgcttcacagtgctaatattgcttcaaaattattacaagaattgggaggtggtaag
ctaatcgggcccgttctttgcggaattaagaaatcaattcaaattgtgcaaatgggctcc
actgaatcagatgttttaaatatggcggcaatggcagcttaccgcaattctgattttgca
gataagtag

DBGET integrated database retrieval system