KEGG   Endosymbiont of Acanthamoeba sp. UWC8: I862_03120Help
Entry
I862_03120        CDS       T03255                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
eaa  Endosymbiont of Acanthamoeba sp. UWC8
Pathway
eaa00020  Citrate cycle (TCA cycle)
eaa00190  Oxidative phosphorylation
eaa00650  Butanoate metabolism
eaa01100  Metabolic pathways
eaa01110  Biosynthesis of secondary metabolites
eaa01120  Microbial metabolism in diverse environments
eaa01130  Biosynthesis of antibiotics
eaa01200  Carbon metabolism
Module
eaa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eaa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
eaa_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    I862_03120 (sdhA)
   00650 Butanoate metabolism
    I862_03120 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    I862_03120 (sdhA)
Enzymes [BR:eaa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     I862_03120 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     I862_03120 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 DAO FAD_binding_3 FAD_oxidored HI0933_like DUF4110 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AIF81185
UniProt: A0A075MJG3
LinkDB All DBs
Position
complement(640123..641907)
Genome map
AA seq 594 aa AA seqDB search
MSTYKIIDHEYDVVVVGAGGAGLRATLGMAEKGLKTACISKVFPTRSHTVAAQGGISAAL
GNMGEDDWRWHAYDTVKGSDWLGDQDAIQYMCQNAPQAIIELEHYGVPFSRTKEGKIYQR
PFGGMTTEYGEGKAAQRTCAAADRTGHAILHTLYQQCLKRNAEFFIEYFSLDLIMVDGEC
RGVTAYCLEDGTLHRFKAHLVVLATGGYGRAYFSATSAHTCTGDGGGMALRAGLPLQDME
FVQFHPTGIYGAGCLITEGVRGEGGYLINSNGERFMERYAPTAKDLASRDVVSRSMMMEI
REGRGCGANKDHIHLVLSHLDPKVIHERLPGISETARIFAGVDVTKQPIPVLPTVHYNMG
GIPTNYMGEALTKKGEEMVEVPGLMAIGEAACVSVHGANRLGSNSLLDLIVFGRAAGIRA
AELVKPQTPHKELPKNAFELGFARFDKIRNSSGKLHTSEIRKEMQKTMQTHASVFRTEEV
MAEGVEMMKNVYSSYQDIGISDRGLIWNSDLVEALELDNLRAQAVVTINAALNRKESRGA
HAREDYSERDDKNWMKHSLTYLDDKGEVSIDYRPVVLTTLDEEMKVIPPKKRVY
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgtataaaattattgatcatgaatatgatgtggttgtggtcggagcaggtgga
gccggattaagagcaacccttggtatggctgaaaaaggtttaaaaaccgcatgtatttca
aaagtgttccctactcgaagccacacggttgctgcgcaaggcggaattagcgccgcactc
ggcaatatgggagaagatgattggcgttggcatgcatatgacacggttaaaggctcggat
tggctcggagatcaggatgcaatccagtatatgtgccaaaatgcgccgcaagcaatcatt
gaacttgagcattacggtgtgccgttttcacgtacaaaggaaggaaagatttatcaacgc
ccgttcggcgggatgactaccgagtacggtgaaggtaaagctgcacaaagaacatgtgct
gctgccgatagaaccgggcatgctattttacatactttatatcagcaatgcttaaaacgt
aatgcagagttctttattgaatatttctcccttgatctaatcatggttgacggtgagtgt
agaggggtgactgcatattgtttggaagacggaacgctgcaccgttttaaagctcatctg
gtcgtacttgctacgggcggatacggcagggcttatttctcggcaacttctgcgcacacc
tgcaccggtgatggcggtggtatggcgttaagagcaggattaccactacaggatatggaa
tttgttcaattccacccgaccggtatttacggagcaggatgtttaatcaccgaaggggtg
agaggagaaggtggatatcttataaacagcaacggtgaaagatttatggagcgttacgct
ccgaccgctaaagacttagcttcaagggatgtagtaagtcgctcgatgatgatggagatc
agagaaggaagaggatgtggcgcaaataaagatcatattcacttagtgctttctcacctt
gatccgaaagtaattcatgaaaggctaccgggtatatcggagacggccagaatatttgca
ggcgtcgatgtaaccaaacaacctataccggtgctacctaccgtgcattataatatgggc
ggtataccgactaactatatgggtgaagctttaactaaaaaaggcgaagaaatggtggaa
gttccagggcttatggcgatcggggaagctgcatgtgtttcagtccatggtgctaataga
ttaggatctaactcactacttgatttaatcgtgttcggaagagcggcgggaattagagcg
gctgaactggttaaacctcaaacaccgcataaggaattaccgaaaaatgcttttgaactt
ggatttgcaagatttgataaaatcagaaactcaagcggtaaacttcatacctcggaaatt
aggaaagagatgcaaaaaaccatgcagacccatgccagtgtctttaggacggaagaagtg
atggctgaaggggtggaaatgatgaagaatgtttatagctcatatcaggatatcggtata
tccgatagagggttgatttggaacagtgatctggtcgaggctttggaacttgataattta
agagcgcaagcagtggtaaccatcaatgcggctttaaatagaaaagaaagtaggggagcg
cacgccagagaagattattcagagcgtgatgataaaaattggatgaagcatagcttaact
tatttagatgataaaggagaggttagcattgattaccgccctgtggttcttactactcta
gatgaggaaatgaaagtgattccgcctaaaaaacgagtgtattaa

DBGET integrated database retrieval system