KEGG   Escherichia coli ABU 83972: ECABU_c07940Help
Entry
ECABU_c07940      CDS       T01995                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
eab  Escherichia coli ABU 83972
Pathway
eab00010  Glycolysis / Gluconeogenesis
eab00260  Glycine, serine and threonine metabolism
eab00680  Methane metabolism
eab01100  Metabolic pathways
eab01110  Biosynthesis of secondary metabolites
eab01120  Microbial metabolism in diverse environments
eab01130  Biosynthesis of antibiotics
eab01200  Carbon metabolism
eab01230  Biosynthesis of amino acids
Module
eab_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eab_M00002  Glycolysis, core module involving three-carbon compounds
eab_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECABU_c07940 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    ECABU_c07940 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECABU_c07940 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eab04131]
    ECABU_c07940 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eab04147]
    ECABU_c07940 (gpmA)
Enzymes [BR:eab01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ECABU_c07940 (gpmA)
Membrane trafficking [BR:eab04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ECABU_c07940 (gpmA)
Exosome [BR:eab04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ECABU_c07940 (gpmA)
  Exosomal proteins of melanoma cells
   ECABU_c07940 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: ADN45374
LinkDB All DBs
Structure
PDB: 

Position
complement(816729..817481)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacctctgtgctg
aaacgcgctattcataccctgtggaatgtgttggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcagggtctgaacaaa
gcggaaaccgctgaaaagtatggcgacgagcaggtgaaacagtggcgtcgtggttttgcg
gtgactccgccggaactgactaaagatgatgagcgttatccggggcacgatccgcgttac
gcgaaactgagcgagaaagagctgccgctgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaaccattctgccacgtatgaagagcggtgagcgcgtcatc
atcgccgcacacggtaactcgttacgtgcgctggtgaaatatctcgataacatgagcgaa
gaagagattcttgagctgaatatcccgaccggcgtgccgctggtttatgagtttgacgag
aacttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcggcgaaagca
gcggcggttgctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system