KEGG   Escherichia coli ABU 83972: ECABU_c07950Help
Entry
ECABU_c07950      CDS       T01995                                 

Gene name
galM
Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
eab  Escherichia coli ABU 83972
Pathway
eab00010  Glycolysis / Gluconeogenesis
eab00052  Galactose metabolism
eab01100  Metabolic pathways
eab01110  Biosynthesis of secondary metabolites
eab01120  Microbial metabolism in diverse environments
eab01130  Biosynthesis of antibiotics
Module
eab_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:eab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECABU_c07950 (galM)
   00052 Galactose metabolism
    ECABU_c07950 (galM)
Enzymes [BR:eab01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     ECABU_c07950 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADN45375
LinkDB All DBs
Position
complement(817684..818724)
Genome map
AA seq 346 aa AA seqDB search
MLNETPALAPDGQPYRLLTLRNNAGMVVTLMDWGATLLSARIPLSDGSVREALLGCASPE
CYQDQAAFLGASIGRYANRIANSRYTFDGETVTLSPSQGVNQLHGGPEGFDKRRWQIVNQ
NDRQVLFALSSDDGDQGFPGNLGATVQYRLTDDNRISITYRATVDKPCPVNMTNHVYFNL
DGEQSDVRNHKLQILAEEYLPVDEGGIPHDGLKSVAGTSFDFRNAKIIASEFLADDDQRK
VKGYDHAFLLQAKGDGKKVAAHVWSADEKLQLKVYTTAPALQFYSGNFLGGTPSRGTEPY
ADWQGLALESEFLPDSPNHPEWPQPDCFLRPGEEYSSLTEYQFIAQ
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaacgaaactcccgcactggcacccgatggtcagccgtaccgactgttaactttg
cgtaacaacgcagggatggtagtcacgctgatggactggggtgcgactttactttccgcc
cgtattccgctttccgatggcagcgtccgcgaggcgctgcttggctgcgccagcccggaa
tgctatcaggatcaggccgcatttctgggggcctctattggtcgttatgccaaccgcatc
gccaatagccgttatacctttgacggtgaaaccgtgacgctttcaccaagtcagggcgtc
aaccaattgcatggcggcccggaagggttcgacaaacgtcgctggcagattgtgaaccag
aacgatcgtcaggtgctgtttgccctgagttcagatgatggcgatcagggtttcccgggt
aatctcggcgcgacggtgcaatatcgtctgaccgacgataaccgtatctccattacttat
cgcgccacagttgataaaccttgcccggtgaatatgactaatcacgtctatttcaatctt
gacggcgagcaatctgacgtgcgcaatcacaagttgcagattctggcggaagaatatctg
ccggttgatgaaggcggcattccgcacgacggcctgaaatctgtcgccggaacctctttt
gatttccgcaacgccaaaatcatcgccagtgagtttcttgccgacgacgatcagcgcaaa
gtgaaaggttacgatcacgcgttcttgttacaggccaaaggcgatggcaagaaagtggcg
gcgcatgtctggtcagcagatgaaaaattgcagctgaaggtctacaccaccgctccggct
ctgcaattctactccggcaacttcctcggcggcacaccgtcgcggggaaccgaaccttac
gccgactggcaagggctggctctggaaagcgaatttctgccggacagcccgaaccaccct
gaatggccgcaaccggactgcttcctgcgtcctggcgaagagtattccagcctgacggaa
tatcagtttattgctcagtaa

DBGET integrated database retrieval system