KEGG   Escherichia coli ABU 83972: ECABU_c29260Help
Entry
ECABU_c29260      CDS       T01995                                 

Gene name
gabP
Definition
(GenBank) gamma-aminobutyrate transport protein
  KO
K11735  GABA permease
Organism
eab  Escherichia coli ABU 83972
Brite
KEGG Orthology (KO) [BR:eab00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eab02000]
    ECABU_c29260 (gabP)
Transporters [BR:eab02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ECABU_c29260 (gabP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease AA_permease_2 Spore_permease
Motif
Other DBs
NCBI-ProteinID: ADN47412
LinkDB All DBs
Position
2995130..2996530
Genome map
AA seq 466 aa AA seqDB search
MGQSSQPHELGGGLKSRHVTMLSIAGVIGASLFVGSSVAIAEAGPAVLLAYLFAGLLVVM
IMRMLAEMAVATPDTGSFSTYADKAIGRWAGYTIGWLYWWFWVLVIPLEANIAAMILHSW
VPGIPIWLFSLVITLALTGSNLLSVKNYGEFEFWLALCKVIAILAFIFLGAVAISGFYPY
ADVSGISRLWDSGGFMPNGFGAVLSAMLITMFSFMGAEIVTIAAAESDTPEKHIVRATNS
VIWRISIFYLCSIFVVVALIPWNMPGLKAVGSYRSVLELLNIPHAKLIMDCVILLSVTSC
LNSALYTASRMLYSLSRRGDAPAVMGKINRSKTPYVAVLLSTGAAFLTVVVNYYAPAKVF
KFLIDSSGAIALLVYLVIAVSQLRMRKILRAEGSEIRLRMWLYPWLTWLVIGFITFVLVV
MLFRPAQQLEVISTGLLAIGIICTVPIMARWKKLIMWQKTPIHNTR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggggcaatcatcgcaaccacatgagttaggcggcgggctgaagtcacgccacgtcacc
atgttgtctattgccggtgttatcggcgcaagtctgtttgtcggttccagcgtcgccatc
gccgaagcgggcccggcggtattactggcctatctgttcgccggattactggtggttatg
attatgcggatgttggcggaaatggcggttgccacgcccgataccggttcattttccacc
tatgccgataaagccattggccgctgggcgggctataccatcggctggttgtactggtgg
ttttgggtactggttatcccacttgaagccaacatcgccgccatgatcctgcactcgtgg
gttccaggcattcccatctggttattttccctcgtcattaccctcgccttaaccggcagt
aatttattaagcgttaaaaactacggcgaatttgagttctggctggcgctgtgtaaagtc
atcgctatcctggcctttattttccttggtgccgtcgcaattagcggtttttacccgtat
gccgacgtgagcggtatttcaagattgtgggatagcggcggctttatgcccaacggcttc
ggtgcggtattaagcgcgatgttgatcaccatgttctcgtttatgggcgcagaaattgtc
accattgccgccgcggaatccgacacgccggaaaaacatattgtccgcgccaccaactcg
gttatctggcgtatctctattttctatttgtgttctatttttgtcgttgtggcattaatc
ccgtggaatatgccagggctgaaagccgttggttcttatcgctcggttctggaattgctc
aatattcctcatgcgaaattaatcatggactgcgtgatattactttccgtaaccagctgc
ctgaactcggcgctgtataccgcttccaggatgctctactccttaagccgtcgcggtgat
gctcccgcggtaatgggtaaaatcaaccgcagtaaaaccccgtacgtggcggtgttactc
tccaccggcgcggcattcttaacggtggtggtgaactattacgcgcctgcgaaggtgttt
aaatttctgatcgacagctccggcgctatcgccctgctggtttatttagtcatcgccgtt
tcacaattgcggatgcgcaaaattctgcgagcagaaggaagcgaaattcgcctgcggatg
tggctttatccgtggctcacctggctggtcatcggctttattacctttgtgttggtagtg
atgctattccgcccggcgcaacagttagaagtgatctccaccggcttattagcgattggg
attatctgtaccgtgccaattatggctcgctggaaaaagctgataatgtggcaaaaaaca
cccattcataatacgcgctga

DBGET integrated database retrieval system