KEGG   Peptoclostridium acidaminophilum: EAL2_808p04810Help
Entry
EAL2_808p04810    CDS       T03061                                 

Gene name
aor
Definition
(GenBank) tungsten-containing aldehyde ferredoxin oxidoreductase Aor
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
eac  Peptoclostridium acidaminophilum
Pathway
eac00030  Pentose phosphate pathway
eac01100  Metabolic pathways
eac01120  Microbial metabolism in diverse environments
eac01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EAL2_808p04810 (aor)
Enzymes [BR:eac01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     EAL2_808p04810 (aor)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AHM57984
UniProt: W8T8E5
LinkDB All DBs
Position
EAL2_808p:complement(482975..484807)
Genome map
AA seq 610 aa AA seqDB search
MKMYGYCGKVIRINLTDGSIKKEALDLEKAKKYIGARGLGVKTFIDEVDPKVDPFSEENK
FIIAGGPLTGAPVPTSGRYMVVTKAPLTGTIAISNSGGKWGAEFKFAGYDMMILEGKSEK
PVYINIDDDSIEIRDASEIWGKVVSETTDYLRKVHGDKSKVLCIGPGGENLSLMAAVMND
VDRAAGRGGVGAVLGSKNLKAIVVRGTNKVALADDEKTKQVSSDKTGILMKDPVAGGGLP
TYGSAVLVNIINENGVLPVRNFQESYTDQADKISGETLTEKYLIKKNPCYRCPIACGRWV
KLDDGTECGGPEYETIWSFGADCDNYDLNSVDVANMLCNEYGLDTISVGATIAAAMELYQ
RGYIKDEEIKGDGVSLDWGDSKAIVAWTKKIGLREGFGDRMADGSYRLCDSYGVPEYSMT
VKKQELPAYDPRAIQGHGITYAVNNRGGCHIKGYMISPEILGYPEKLDRFSDEGKAAYAK
VFHDLTAVIDSLGLCIFTTFGLGLPDYVDMYNAVVGEEHDNESLLRAGDRIWTLEKLFNL
KAGLTKADDTLPKRLLEDPIADGPSKDNVHHLDVLLPEYYSVRGWDENGLPTDETLRTLG
LEEYIGYIEK
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgtacggttactgcggaaaggtaataagaatcaacttaacagacggcagcatt
aaaaaagaggctctcgatctggaaaaggcaaaaaagtatatcggtgccaggggtctgggc
gtaaaaacctttattgacgaagttgatccaaaggtcgatccattttccgaagagaacaag
ttcataatagccggcggacctcttacgggtgccccggtgccaaccagtggccggtatatg
gttgtaacaaaagcacctcttacaggcaccatagctatttcaaattcaggcggaaaatgg
ggcgcggagtttaaattcgcaggttatgacatgatgattctggaagggaagtcagaaaag
cctgtatacatcaacattgacgatgattcaatagaaatcagggatgcatcagaaatctgg
ggcaaggtcgtatccgagacaacagactacctgaggaaagtgcacggggacaagtcaaag
gttctctgcattggaccgggaggagaaaacctttcgctaatggcagcagtcatgaatgat
gtggacagggctgcgggcagaggcggagtaggcgccgttcttggctctaagaatctcaag
gccattgttgtaagaggaacaaacaaagttgcgctggccgatgatgaaaagacgaagcag
gtttccagcgataaaacaggaatacttatgaaggaccctgttgcgggcggaggtcttccg
acatatggttccgcagtgcttgtcaacataatcaatgaaaacggagttttgcctgttagg
aacttccaggaatcctacactgaccaggcagataaaataagcggggaaacacttacagaa
aaatacctgatcaagaaaaatccttgttacaggtgcccgatagcatgcggcagatgggtt
aagctcgatgacggaactgagtgcggaggacctgaatacgagaccatttggtcatttggt
gcagactgtgacaactatgatttgaactctgttgatgttgcaaatatgctttgcaacgaa
tacggtctcgatacaatatccgtgggagctacaatagcagcagccatggaactctatcag
agaggctatataaaagacgaggaaatcaaaggggacggagtatcgcttgactggggcgac
tcaaaggctattgtggcctggacaaagaagataggcctgagggaaggcttcggcgacagg
atggctgacggctcgtacaggctgtgtgattcttacggggtgcctgagtactccatgaca
gtcaagaaacaggagcttcctgcctatgacccacgagcaatccagggtcacggcataaca
tacgctgtcaacaacagagggggctgccatataaaaggatacatgataagcccggaaatt
ttgggatatcccgagaagctcgacagattctcagacgagggaaaagcagcctatgccaag
gtgttccacgaccttacagctgtaatagattcgttgggtctttgtatattcacaaccttc
ggacttggacttcctgactatgtcgatatgtacaatgcggttgtcggagaagagcatgac
aacgaatcgctcctacgtgctggggacaggatatggacacttgagaagctgttcaacctc
aaggcaggactgacaaaggccgacgatacacttccaaagagacttctcgaagaccctata
gcagacggaccgtcaaaggacaatgttcaccaccttgatgtgcttctgcctgaatactac
agcgtcagaggctgggacgaaaacggccttcctacggatgagactctcaggactctggga
ctcgaagagtacattggttatatcgagaaataa

DBGET integrated database retrieval system