KEGG   Peptoclostridium acidaminophilum: EAL2_c06640Help
Entry
EAL2_c06640       CDS       T03061                                 

Definition
(GenBank) aminotransferase class I and II
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
eac  Peptoclostridium acidaminophilum
Pathway
eac00220  Arginine biosynthesis
eac00250  Alanine, aspartate and glutamate metabolism
eac00270  Cysteine and methionine metabolism
eac00330  Arginine and proline metabolism
eac00350  Tyrosine metabolism
eac00360  Phenylalanine metabolism
eac00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eac00401  Novobiocin biosynthesis
eac01100  Metabolic pathways
eac01110  Biosynthesis of secondary metabolites
eac01130  Biosynthesis of antibiotics
eac01210  2-Oxocarboxylic acid metabolism
eac01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eac00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EAL2_c06640
   00270 Cysteine and methionine metabolism
    EAL2_c06640
   00220 Arginine biosynthesis
    EAL2_c06640
   00330 Arginine and proline metabolism
    EAL2_c06640
   00350 Tyrosine metabolism
    EAL2_c06640
   00360 Phenylalanine metabolism
    EAL2_c06640
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EAL2_c06640
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    EAL2_c06640
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:eac01007]
    EAL2_c06640
Enzymes [BR:eac01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     EAL2_c06640
Amino acid related enzymes [BR:eac01007]
 Aminotransferase (transaminase)
  Class I
   EAL2_c06640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_MocR ILVD_EDD Gp58
Motif
Other DBs
NCBI-ProteinID: AHM55965
UniProt: W8T522
LinkDB All DBs
Position
656232..657551
Genome map
AA seq 439 aa AA seqDB search
MSKPVVSAHFASRKPSDVRLAQMKYDERKVKPQEVINVGIGNVSLPTNPAMQKRMFALDA
PESPFSKGVIRYTGTAGTPECQEAFKNILRCQGYDTSKLHVAVTDGGSSGMELLLVGVCG
PAGTDEQPLMMIDPAYTNYISFGERLGRKTVSVKRHMGDDGKFNLPEMNEIEEAIKNNKP
GALLVIPYDNPTGQLYTIEMMKDLAKLCVKYNMWMISDEAYRELYYDPDKELISVWNLSD
ADVPGIEGRRISLDTASKVWNACGLRIGALITDNEEFYNRAVAEYTANLCANAIGQYIFG
ALAHQTKDEIAAWAKEIRDYYQEIILNVYNGLKEQEPKLIVSSPDASIYSVIDVRNVVKP
GFDAIDFVLYCAQEGSAVIDGVETTLLVAPMKGFYESVEGEYNPGTTQFRISFVESPEKM
AKVPELFVKLLRQYEAKRA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaccagttgtttcagcgcattttgcatcaagaaaaccatcggatgttagattg
gctcagatgaaatacgatgaacgtaaggttaagcctcaggaagttatcaacgttggcatt
ggaaacgtttccctacctaccaacccagcgatgcagaagagaatgtttgcacttgatgct
cctgaaagtccattttccaaaggtgttatcagatatacaggaactgcgggcactccagag
tgccaagaggcgttcaagaatatcctaagatgtcagggctatgacacaagcaaattgcac
gtagcagttacagatggcggatcttcaggtatggagcttcttcttgtcggtgtttgcgga
cctgcaggtacggatgaacagccactgatgatgattgatccagcttatacgaattatata
tctttcggagaaagattgggacgcaaaacggtttctgttaagcgtcacatgggagatgac
ggaaagttcaatcttcctgaaatgaatgagatcgaagaagctattaaaaataacaagcca
ggagcactgcttgtaattccttatgacaaccctacgggacagctttatactatcgagatg
atgaaggaccttgcaaagctttgcgttaaatacaacatgtggatgattagcgacgaagcc
tatcgtgagctatattatgatccagacaaggagcttataagcgtttggaacctaagcgat
gcggatgttcctggcatcgaaggcagaaggataagccttgacactgcttcaaaggtatgg
aatgcttgtggacttagaatcggtgctctaatcactgacaatgaagaattctacaatcgt
gcagttgctgaatatactgccaacctatgcgcaaatgccatcggccagtatatatttggt
gcattggcacatcaaacaaaagatgaaattgcagcatgggcgaaggaaattcgcgactat
taccaagaaataattttgaatgtttataacggcttgaaagagcaggagcctaagcttata
gtttctagcccggatgcttctatatattcggttatagatgttagaaacgttgtaaagcca
ggatttgatgctattgatttcgttctatattgtgcgcaggaaggctctgcagttatagac
ggagttgaaacaacacttcttgttgcgcctatgaagggcttctatgagagtgtagagggc
gaatacaatccaggaacaactcagttccgtatatcgttcgtagaatcaccagagaaaatg
gcgaaggtgccagagctgttcgttaagcttcttagacaatacgaggctaaaagagcatag

DBGET integrated database retrieval system