KEGG   Ensifer adhaerens OV14: OV14_0139Help
Entry
OV14_0139         CDS       T03054                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
ead  Ensifer adhaerens OV14
Pathway
ead00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ead01100  Metabolic pathways
ead01110  Biosynthesis of secondary metabolites
ead01130  Biosynthesis of antibiotics
ead01230  Biosynthesis of amino acids
Module
ead_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ead00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OV14_0139
Enzymes [BR:ead01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     OV14_0139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 TsaE AAA
Motif
Other DBs
NCBI-ProteinID: AHK42262
UniProt: W8HVX9
LinkDB All DBs
Position
1:complement(116718..117308)
Genome map
AA seq 196 aa AA seqDB search
MNDVIEPVSATLAERAKLALGKRNLVFIGLMGAGKSAIGRLAAQALGIPFVDSDHEIERV
SRMTISDLFARYGEDEFRALEARVLKRLLRTGPRVVSTGGGAYINERSRRQIKRGGLTIW
LNAELDVLWERVNKRDTRPLLKTENPKQTLENLMRARYPIYAEADLTVMSRDVSKETMVE
DVLTAVIDFRKVPNDE
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgtgatcgaaccggtttccgcgacgcttgccgaacgggcgaagcttgcgctc
ggtaaacgcaatctcgttttcatcggcctgatgggcgccggaaaatccgcgatcggccgg
ttggcggcgcaggcgctcggcattcccttcgtcgattccgaccacgagatcgagcgcgtc
tcgcgcatgacgatcagcgatctctttgcccgctacggcgaggacgaatttcgggcgctg
gaagcacgtgtgttgaaacgcctgctgcgcaccggcccccgtgtcgtttccaccggcggc
ggcgcctatatcaacgagcgatcgcgccgccagatcaagcgcggcggcttgacgatctgg
ctcaatgccgaattggacgtgctctgggagcgggtcaacaagcgcgacacacgtcctctg
ttgaagaccgagaaccccaagcagacgctcgaaaacctgatgcgcgcccgctacccgatc
tacgccgaagccgatctgacggtgatgtcgcgcgatgtgagcaaggagacgatggtggag
gacgttctcaccgccgtcatagatttccggaaagtgccaaatgatgaatag

DBGET integrated database retrieval system