KEGG   Ensifer adhaerens OV14: OV14_0570Help
Entry
OV14_0570         CDS       T03054                                 

Gene name
glpD2
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ead  Ensifer adhaerens OV14
Pathway
ead00564  Glycerophospholipid metabolism
ead01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ead00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    OV14_0570 (glpD2)
Enzymes [BR:ead01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     OV14_0570 (glpD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 Pyr_redox_2 FAD_oxidored NAD_binding_8 STPPase_N
Motif
Other DBs
NCBI-ProteinID: AHK42601
UniProt: W8HX99
LinkDB All DBs
Position
1:561889..563406
Genome map
AA seq 505 aa AA seqDB search
MAEQAIFDVFIIGGGINGCGIARDAVGRGYSVALAEMNDFASGTSSGSTKLIHGGLRYLE
HYEFRLVREALMEREVLWAMAPHVIWPMRFVLPYHKGGPRPAWLIRLGLFLYDHIGGRKL
LPATATLDMTRDPAGKPLKRLFTKAFEYSDGWVNDARLVVLNARDAADRGARIMARTRVI
SAKRDNGNWVVDTENAATGERRQIRARMLVNAAGPWVDAVLSGALGKNDVHNVRLVQGSH
IVVRKKFNDPRAYFFQNPDGRIMFAIPYEDDFTLIGTTDRDYTGNPADVRISDAEVDYLC
KAASEYFLEPIEKDDIVWTYSAVRPLFDDGASKAQEATRDYVLRVEGDRAAAPLLNVFGG
KLTTYRRLSESALEKIGDAIGVKGAKWTAGSSLPGGDFPAKGYADEVAKLHKKYPFLAAG
HVRRLVRLYGTRASALIGAAANEAALGHHFGADLYEAEVKWLIEQEWARHAEDVLWRRTK
LGLKLTSGEATALEEYMRGAAHAAA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtggcagagcaggcaatcttcgacgtcttcattatcggcggcggcatcaacggatgcggc
attgcgcgtgatgcggtcggtcggggatactccgtcgcgctcgctgaaatgaacgacttt
gcctccggcacgtcgtccggctcgaccaagctcatccacggcggcctgcgctatctcgaa
cattatgagttccgcctggtgcgcgaggcgctgatggagcgcgaagtgctctgggcaatg
gcaccgcacgtcatctggccgatgcgcttcgtccttccctatcataagggcggcccgcgc
ccggcctggctcatccgcctcggcctgtttctttacgaccatattggcggccgcaagctg
ctgccggcaacggccacgctcgacatgacgcgcgatccggccggaaagccgctgaagcgg
ctctttaccaaggctttcgaatattccgacggttgggtcaacgatgcccgactggtcgtg
ctcaatgcccgcgatgccgccgaccgcggcgcccggatcatggcgcgcacccgggtgatc
tcggcaaagcgcgacaacggcaactgggtggtcgacacggaaaatgccgcgaccggcgaa
cgtcggcagatccgagcgcgcatgctggtcaatgccgcaggcccttgggtcgatgcggta
ctatcaggcgcgctcggcaagaacgacgttcacaatgtgcgcctggtccagggcagccac
atcgtcgtccgcaagaagttcaacgacccccgcgcctatttcttccagaatccggatggc
cggatcatgttcgccatcccctatgaggacgatttcacgctgatcggcaccaccgatcgc
gactataccggcaacccggccgacgtccgcatcagcgacgccgaggtcgactacctctgc
aaggccgcgagcgagtatttcctcgagccgatagaaaaggacgacatcgtctggacctat
tccgccgttcgcccgctgttcgacgacggcgccagcaaggcgcaggaagcaacccgcgac
tacgttcttcgcgtcgaaggcgacagggccgcggccccgctcctcaacgttttcggcggc
aagctgacgacctatcgccgcctgagcgaatccgcgctcgagaagatcggcgatgccatc
ggcgtcaagggtgccaagtggaccgccggctcaagcctgccgggcggggacttcccggcc
aagggctacgccgacgaagtcgcaaaacttcacaagaagtatcccttccttgccgccggc
catgtgcgtcggctggtacgcctctacggcacgcgcgcgtccgcgctcattggagcggca
gcgaatgaagcagcccttggccatcatttcggcgccgacctctatgaggcggaagtgaag
tggctgatcgagcaggaatgggcccggcacgccgaggacgtgctgtggcggcgcaccaaa
ctgggattgaagctgacgtccggcgaggcgacggcgctggaggaatacatgcggggcgcg
gcgcacgccgccgcctga

DBGET integrated database retrieval system