KEGG   Ensifer adhaerens OV14: OV14_2395Help
Entry
OV14_2395         CDS       T03054                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ead  Ensifer adhaerens OV14
Brite
KEGG Orthology (KO) [BR:ead00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ead03012]
    OV14_2395
   03029 Mitochondrial biogenesis [BR:ead03029]
    OV14_2395
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ead04147]
    OV14_2395
Translation factors [BR:ead03012]
 Eukaryotic Type
  Elongation factors
   OV14_2395
 Prokaryotic Type
   OV14_2395
Mitochondrial biogenesis [BR:ead03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    OV14_2395
Exosome [BR:ead04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   OV14_2395
  Exosomal proteins of breast cancer cells
   OV14_2395
  Exosomal proteins of colorectal cancer cells
   OV14_2395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: AHK44083
UniProt: W8I6C6
LinkDB All DBs
Position
1:2328422..2329597
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEYKAYDQIDAAPEEKARGITIST
AHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYEFPGDDIPIIKGSALAALEDSDKK
IGEDAIRELMAAVDAYIPTPERPIDLPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEV
EIVGIRDTSKTTVTGVEMFRKLLDQGQAGDNIGALIRGVNRDGVERGQILCKPGSVKPHK
KFMAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVTVAVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaaatttgagcgcaacaagccgcacgttaacattggcacgattggccac
gttgaccatggcaagacgtcgctgactgcagcgatcacgaagtacttcggcgagtacaag
gcgtacgaccagatcgacgctgctccggaagaaaaggcccgtggtatcacgatttcgacg
gctcacgttgagtatgagacggcgaaccgtcactacgcgcacgtcgactgccccggccac
gccgactacgtcaagaacatgatcaccggtgcagcgcagatggacggcgcgatcctggtt
tgctcggctgctgacggcccgatgccgcagacccgcgagcacatcctgcttgctcgccag
gttggcgttccggccatcgtcgtgttcctcaacaaggtcgaccaggttgacgacgccgag
cttctcgagctcgtcgagcttgaagttcgcgaactgctgtcgtcctacgaattcccgggc
gacgacattccgatcatcaagggttcggcacttgctgctcttgaagattcggacaagaag
atcggcgaagacgcgatccgcgagctgatggccgctgttgacgcctacatcccgacgcct
gagcgtccgatcgacctgccgttcctgatgccgatcgaagacgtgttctcgatctcgggc
cgtggtacggttgtgaccggtcgcgttgagcgcggcattgtcaaggttggcgaagaagtt
gaaatcgtcggcatccgcgacacgtcgaagacgacggttaccggcgttgaaatgttccgc
aagctgctcgaccagggccaggccggcgacaacatcggcgcgctgatccgtggtgttaac
cgtgacggcgttgagcgtggccagatcctgtgcaagccgggttcggtcaagccgcacaag
aagttcatggccgaagcctacatcctgacgaaggaagaaggcggccgtcatacgccgttc
ttcacgaactaccgtccgcagttctacttccgcacgacggacgtgacgggtatcgttacg
cttccggaaggcacggaaatggttatgcctggcgacaacgtcacggttgccgttgagctg
atcgttccgatcgcgatggaagaaaagctgcgcttcgctatccgcgaaggtggccgtacc
gtcggcgccggcatcgttgcttcgatcgtcgagtaa

DBGET integrated database retrieval system