KEGG   Ensifer adhaerens OV14: OV14_3398Help
Entry
OV14_3398         CDS       T03054                                 

Definition
(GenBank) glutathione-S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ead  Ensifer adhaerens OV14
Pathway
ead00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ead00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    OV14_3398
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ead02000]
    OV14_3398
Enzymes [BR:ead01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     OV14_3398
Transporters [BR:ead02000]
 Other Transporters
  Pores ion channels [TC:1]
   OV14_3398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 Tom37 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AHK44755
UniProt: W8I8B3
LinkDB All DBs
Position
1:complement(3255280..3255933)
Genome map
AA seq 217 aa AA seqDB search
MKSRKAKMMKLYGLGPTRSLRALWALQELDADFEFVPVNLLGGENRHPDFLRLNPAGKVP
VLVDGDLVLTESAAIVFYLAEKYADKGLMPTDLNERAQAYRWTLFAVTELEQPLWRIAKH
TFLYPEDKRLPEDIALAKEEFVAMAEVLERHMDGRTFVIGDRISIADCVTVYVIDWGNEV
GLIDGFPNLKAYLERMYARAKAPPRIADALASLEAAG
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatcgaggaaagccaagatgatgaaactctatggattgggtccgacacgttcgctt
cgtgccctttgggcgcttcaggagcttgatgcggacttcgagttcgtgccggtcaacctg
ctgggcggcgaaaaccgtcaccccgattttctgcgcctcaaccccgccggaaaggttccg
gtactggtcgacggagacctggtgctgacggaatccgccgcgatcgtgttctatctggcc
gagaaatacgccgacaaggggctgatgcccaccgacttgaacgagcgggcgcaggcctat
cgctggacgctgtttgccgtcaccgagctggagcagccgctatggcggatcgccaagcac
acattcctataccccgaagacaagcgtctgcccgaggacattgcgcttgccaaggaggag
tttgtggcgatggctgaggtgctcgagcgtcacatggacgggcgtacgttcgtcatcggc
gaccgcatcagcatcgccgattgcgtcaccgtctatgtcatcgactggggcaatgaggtc
gggctgatcgacgggttccccaatctcaaggcctatctcgagcgaatgtatgcgcgcgcc
aaggcgccgccgcggatcgccgacgctcttgcaagcctcgaggctgcgggctga

DBGET integrated database retrieval system