KEGG   Ensifer adhaerens OV14: OV14_3871Help
Entry
OV14_3871         CDS       T03054                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ead  Ensifer adhaerens OV14
Pathway
ead00240  Pyrimidine metabolism
ead01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ead00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    OV14_3871 (tdk)
Enzymes [BR:ead01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     OV14_3871 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22 AAA_19 Flagellin_IN
Motif
Other DBs
NCBI-ProteinID: AHK45097
UniProt: W8I3U1
LinkDB All DBs
Position
1:complement(3708917..3709546)
Genome map
AA seq 209 aa AA seqDB search
MNRQDDFRERQDMAKLYFSYATMNAGKSTLLLQASYNYQERGMRVVMLIAAFDDRAGTGR
ISSRIGLDADAIPFHGGDDLYALIEKLNTDGAGQIACVFVDEAQFLDEEQVWQLARVADR
IGVPVMAYGLRTDFQGKLFPGSMALLAIADELREVRTICDCGRKATMVVRLDGQGNVVRE
GAQVEVGGNEKYVSYCRRHWEDKMRCDPA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggcaagacgatttccgggaacggcaggatatggccaaactctatttcagctat
gcgacgatgaatgcgggcaagagcacattgctgctgcaggcatcctacaactaccaggaa
cgcggcatgcgcgtcgtcatgctgatcgcagcgttcgacgaccgtgccggcaccgggcgc
atttcgtcacgcatcggcctcgatgcggatgccattccgttccacggtggcgacgatctc
tacgcgttgatcgaaaagctcaacaccgatggtgcgggccagattgcctgcgtcttcgtc
gacgaagcgcagtttctcgacgaggagcaggtctggcagctggcgcgggtcgccgaccgc
atcggcgttcccgtcatggcctacgggttgcgcaccgatttccaaggcaagctttttccg
ggctcgatggcgctgctggccattgccgacgagctgcgcgaagtgcgcacgatctgcgac
tgcggccgcaaggcgaccatggtcgtccgtctcgacgggcagggcaacgtcgttcgcgaa
ggcgcccaggtcgaggtcggcggcaacgagaaatatgtctcctattgccggcgccattgg
gaagacaagatgcgctgcgaccccgcctga

DBGET integrated database retrieval system