KEGG   Ensifer adhaerens OV14: OV14_3934Help
Entry
OV14_3934         CDS       T03054                                 

Definition
(GenBank) putative ATP-binding component of ABC transporter protein
  KO
K10548  putative multiple sugar transport system ATP-binding protein [EC:7.5.2.-]
Organism
ead  Ensifer adhaerens OV14
Pathway
ead02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ead00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    OV14_3934
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ead02000]
    OV14_3934
Transporters [BR:ead02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Multiple sugar transporter
    OV14_3934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 SMC_N RsgA_GTPase AAA_23 AAA_22 AAA_15 AAA_27 MCM AAA_30
Motif
Other DBs
NCBI-ProteinID: AHK45146
UniProt: W8I440
LinkDB All DBs
Position
1:complement(3775598..3777133)
Genome map
AA seq 511 aa AA seqDB search
MDNIILEMRGITKTFPGVKALDNVSFKVREGEIHALVGENGAGKSTLMKVLSGVYPAGTY
DGEIYYDGEPRRFSTISDSEHLGIIIIHQELALVPLLSIAENIFLGNEIATNGVIHWPQT
FARTQELLKKVGLSEPPATLITDIGVGKQQLVEIAKALSKKVRLLILDEPTASLNENDSD
ALLKLLMEFRAQGMTSIIISHKLNEIRKVADQITILRDGGTVETLDCQTEDIGEDRIIKG
MVGRAMEDRYPPREPKIGETLLEVKNWNVFHQHHRDRQFLHDVNFTVRAGEVVGIAGLMG
AGRTETAMSIFGKSWGHKITGDVLMRGKPVDVSTIPRAIDAGLAYVTEDRKQLGLVLINN
IKENTTLSNLKAVASNGVIDDRKEVKVASDYRSKLRIRSHSIYQETVNLSGGNQQKVVLS
KWLFTNPEVLILDEPTRGIDIGAKYEIYTIINQLAAEGKGIVMISSEMPELLGTCDRIYV
MNEGRIVAELSKAEASQESIMRAIMRSGEKH
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggacaatatcattctcgaaatgcgtggcatcaccaagacgtttccgggcgtcaaggcg
ctggacaatgtcagcttcaaggttcgcgaaggtgagatccacgctctggtcggtgaaaac
ggtgccggcaaatcgacgctgatgaaggtactgagcggcgtctatcccgccggcacctat
gacggcgagatctactacgacggcgagcctcgccgcttctcgaccatctctgacagcgaa
catctcggcatcatcatcatccaccaggaactggcgctggttccgctgctgtcgatcgcc
gaaaacatctttctcggcaacgagatcgccaccaatggggtgatccattggccgcagacc
tttgcccgcacgcaggaacttctgaaaaaggtgggcctgagcgagccgcccgccacgctg
atcactgacatcggcgtcggcaagcagcagctggtcgagatcgccaaggcgctgtcgaag
aaggtgcggctgctgatcctcgacgaaccgaccgcctcgctcaacgaaaacgattctgac
gcgctcttgaagctcttgatggagtttcgcgcgcagggcatgacttcgatcatcatttcg
cacaagctgaacgagatccgcaaggtcgccgaccagatcaccatcctgcgcgacggcgga
accgttgaaacgctcgactgtcagaccgaggatatcggcgaagaccggatcatcaagggc
atggtcggtcgtgcgatggaagatcgttacccgccgcgcgagcccaagatcggcgagacg
ctcttggaagtgaagaactggaacgtcttccaccagcatcaccgcgaccggcagttcctg
cacgacgtcaattttaccgtgcgcgccggcgaagtcgtcggcatcgccggcctgatgggg
gcggggcgaaccgaaacggcgatgagcatcttcggcaagtcctgggggcacaagatcacc
ggcgacgtcctgatgcgcggcaagccggtcgacgtcagcaccatcccccgcgccatcgac
gctggtctcgcctatgtcaccgaagaccgcaagcaactgggtctcgtgctgatcaacaac
atcaaggagaacaccacgctctccaacctgaaggcggtggcgtccaacggcgtcatcgac
gatcgcaaggaggtcaaggtcgcctccgactatcgttcgaagctgcgcatccgctcgcac
tcgatctatcaggaaacggtcaatctttccggcggcaatcagcagaaggtggtgctgtcg
aagtggctgttcaccaatccggaagtcctcatcctcgacgagccgacacgcggtatcgat
atcggcgcgaagtatgagatctacaccatcatcaaccagcttgcagccgagggcaaaggc
atcgtgatgatttcatcggagatgccggaactgcttggaacctgcgaccgcatctacgtc
atgaacgagggccgcatcgtcgccgagctttcaaaggccgaagcgagccaggaatccatc
atgcgtgccatcatgcgttcaggggagaaacactaa

DBGET integrated database retrieval system