KEGG   Ensifer adhaerens OV14: OV14_a0199Help
Entry
OV14_a0199        CDS       T03054                                 

Definition
(GenBank) dipeptide ABC transporter, ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
ead  Ensifer adhaerens OV14
Pathway
ead02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ead00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    OV14_a0199
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ead02000]
    OV14_a0199
Transporters [BR:ead02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    OV14_a0199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 oligo_HPY AAA_22 SMC_N Mg_chelatase DUF87 AAA_16 AAA Sigma54_activat AAA_33
Motif
Other DBs
NCBI-ProteinID: AHK45423
UniProt: W8IKJ4
LinkDB All DBs
Position
2:complement(230564..231394)
Genome map
AA seq 276 aa AA seqDB search
MLVDIKNLRIAFENRSSRFEAVRGISLSLGAEKLGIVGESGSGKSLTARALMKLLPSNAA
ISADRLSFDGIDLLSASEKQMRQIRGKRAGFILQDPKYSLNPVMNIGRQVAEAWRAHKGG
SKRQALEAAIHLLDQVKIRNPREVAAAYPHEVSGGMGQRVMIAMMLAPDPELLIADEPTS
ALDATVQAEILRLIEELVSERNMGLILISHDLPLVSHFCDRVAVMYSGRVMEELKASELL
NARHPYTKGLLNCMPSLTHPRDRLPVLNRDASWLTA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgctggttgatatcaagaacctccgcatcgccttcgagaaccgctcctcgcgcttcgag
gcggtgcgcggcatctcgctttcactcggcgcagagaaactcggcatcgtcggcgagagc
ggctcgggcaagagcctgacggcacgggcgctgatgaagctgctgccctccaatgccgcc
atatcagccgaccggctctccttcgacggcatcgatttgctctctgcctcggaaaagcag
atgcgccagatccgtggcaagcgggcgggcttcatcctgcaggatccgaaatattcgctc
aacccggtgatgaacatcggccgacaggtggcggaagcctggcgtgcccacaagggcggc
agcaagaggcaagcgctcgaggcggcgatccatctcctcgaccaggttaaaatccgcaat
ccgcgcgaagtcgccgccgcctacccgcacgaagtctcgggcggcatgggccagcgggtg
atgatcgcgatgatgctggcacccgatccggagctgctgattgccgacgaaccgacgagc
gcgctcgatgcgaccgtgcaggcagaaatcctgcggctgatcgaggagctggtgtcggag
cgcaacatgggcctcattctcatcagccacgacctgccgctcgtgtcgcatttctgcgac
cgcgtcgcggtgatgtattccggccgcgtgatggaagagctgaaggcgtccgagctgctg
aacgcccgccacccctataccaaggggcttctcaactgcatgccttccctcacgcatccc
agggaccggttgcctgttctcaaccgcgatgcatcgtggctcaccgcatga

DBGET integrated database retrieval system