KEGG   Ensifer adhaerens OV14: OV14_a0244Help
Entry
OV14_a0244        CDS       T03054                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ead  Ensifer adhaerens OV14
Pathway
ead00061  Fatty acid biosynthesis
ead00780  Biotin metabolism
ead01100  Metabolic pathways
ead01212  Fatty acid metabolism
Module
ead_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ead00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    OV14_a0244 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    OV14_a0244 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ead01004]
    OV14_a0244 (fabZ)
Enzymes [BR:ead01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     OV14_a0244 (fabZ)
Lipid biosynthesis proteins [BR:ead01004]
 Fatty acid synthase
  Component type
   OV14_a0244 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-ProteinID: AHK45458
UniProt: W8IKM5
LinkDB All DBs
Position
2:complement(274140..274628)
Genome map
AA seq 162 aa AA seqDB search
MPLETNHLTSADIARILQCIPHRYPFLLVDRLVSIRGEESCVGIKNVSINEPQFQGHFPG
NPVFPGALIIEGMAQTAGVMCAASKLAQGLTPKIIYMLTVDKARFRKPVRPGDAIAYHMT
KLAYRRNIWRYRGEALVDGALVAEAEISAYLETEGKQPVAAA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcctcttgaaacgaaccatcttacgtcggccgacattgccaggattctgcaatgcatc
ccgcatcgctatccattcctgctcgtcgacaggctcgtctcgatccgtggcgaagaaagc
tgcgtagggatcaagaatgtttcgatcaacgagccgcagtttcaagggcatttccccggc
aatccggtctttcccggagcgctcatcatcgagggcatggcgcagacggcaggcgtcatg
tgtgccgcctccaagctggcgcaagggttgacgcccaagatcatctacatgctgacggtg
gacaaggcacggttccgcaagcccgtccgccctggcgacgccatcgcttatcacatgacc
aagctcgcctatcgccgcaatatctggcgttaccgcggcgaggccctggtcgacggcgcg
ctcgttgccgaggccgagatttcggcatacctggagaccgaagggaagcaacccgtggcg
gcggcttga

DBGET integrated database retrieval system