KEGG   Ensifer adhaerens OV14: OV14_a1443Help
Entry
OV14_a1443        CDS       T03054                                 

Definition
(GenBank) putative solute-binding component of ABC transporter
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
ead  Ensifer adhaerens OV14
Pathway
ead02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ead00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    OV14_a1443
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ead02000]
    OV14_a1443
Transporters [BR:ead02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Iron(III) transporter
    OV14_a1443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_8 SBP_bac_11 SBP_bac_1
Motif
Other DBs
NCBI-ProteinID: AHK46299
UniProt: W8IGC6
LinkDB All DBs
Position
2:1529028..1530044
Genome map
AA seq 338 aa AA seqDB search
MSRRFALASALVSLCSVFSTGSAYAAGMTVYCPMSEDDCASVLKAFKDDSGIEAQFVRIG
AGEILARIRAEKSNPQAGLWLAGAADNFIQAANEGLLAPHKNAGIDKVDQRYTDKEGRWT
PISISPIVFAYSQAVLDETGAKPPTSWKSFADPAFKQSVALAHPASSGTAYVALASMVQL
FGEEPAFELMKTIDENVVQYTRSGVAPSRMVANNEIALAMAYTQDIEAALAQGYPVGYAF
PEEGTGFEVNAAAAIANASEEQSKAAASFLDWVLTEKGQAAIGATFRGPIVPGYKNPEAK
IDLSNVKMIDYNFSWAGENRARLLERYENDVRHKADAK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgccgtttcgcgctggcttcagcgcttgtttccctatgctcagttttctcgacc
ggcagtgcctatgctgccggaatgaccgtctattgcccgatgtcggaagacgattgcgcc
tccgtgctgaaggcattcaaggacgatagcggcatcgaagcacagttcgtgcgcatcggc
gccggcgaaatcctcgcccgcatccgcgcggaaaagagcaatccccaggctggcctgtgg
ctggcaggtgcggccgacaactttatccaggccgccaacgagggcctgctcgcgccgcac
aagaacgccggcatcgacaaggtagaccagcgctacaccgacaaggaaggccgctggacc
cccatctcgatctcgccgatcgtctttgcctacagccaggcggttctcgacgagaccggt
gccaagccgccgacaagctggaaatcctttgccgacccggccttcaagcagagcgtcgcc
cttgcccaccccgcatcctcgggaacggcctacgtggctcttgcctcgatggtccagctt
ttcggcgaggagccggccttcgagctgatgaagacgatcgacgaaaacgtggttcagtac
acgcgctccggcgtcgcgccatcccgcatggtcgccaacaacgagatcgcgcttgccatg
gcctatacgcaggatatcgaggccgcactcgcgcagggttatcccgtcggctacgcgttt
cccgaagagggcaccggtttcgaggtgaatgcggcagcggcaatcgccaacgcatccgag
gagcagtcgaaggccgccgccagcttcctcgactgggtgctcaccgagaagggccaggcc
gccatcggcgcaacgttccgcgggccgatcgtgccgggctacaagaatcctgaagccaag
atcgacctctccaacgtgaagatgatcgactacaacttcagctgggccggcgaaaatcgc
gcgcgcctcctggagcgctatgaaaacgacgtgcgccacaaggctgacgccaagtaa

DBGET integrated database retrieval system