KEGG   Ensifer adhaerens OV14: OV14_a1558Help
Entry
OV14_a1558        CDS       T03054                                 

Gene name
proC2
Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
ead  Ensifer adhaerens OV14
Pathway
ead00330  Arginine and proline metabolism
ead01100  Metabolic pathways
ead01110  Biosynthesis of secondary metabolites
ead01130  Biosynthesis of antibiotics
ead01230  Biosynthesis of amino acids
Module
ead_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ead00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    OV14_a1558 (proC2)
Enzymes [BR:ead01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     OV14_a1558 (proC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored GFO_IDH_MocA SpoVAC_SpoVAEB TrkA_N
Motif
Other DBs
NCBI-ProteinID: AHK46373
UniProt: W8INA1
LinkDB All DBs
Position
2:1645616..1646455
Genome map
AA seq 279 aa AA seqDB search
MKRGDEMEQSEEIVLVGCGNMGFALLEGWLDRAGIPAAQIHVVEPAESLRHRAAARGATV
YDDAAGLPAALRPRAVIIAVKPQVVGSMLGAYRRFRDTSVFVSIAAGVPISTFENTLGNA
AIVRAMPNMPASIGMGVIAAFGSTHIDDNQTGFVTDLLAAVGSVHWLAEERLVDAATAIS
GSGPAYLFHFIECLTGAGIAGGLPPETALALAKQTVIGAAALASTSAFSPAELRRQVTSP
NGTTAAALDVLTSEPSLADLVKRAAAAAHRRALELALGN
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaggcgacgagatggaacagtcagaggaaatcgtgttggtcggctgcggcaac
atgggttttgccttgctcgaaggctggcttgatcgggccggtattcctgcagcccaaatt
catgtggtcgagcctgcggaatctcttcgccaccgcgccgccgcgcgtggcgcaacggtt
tatgatgatgcggccggcttgccggctgccttgcggccgcgcgccgtcataatcgccgtc
aagccgcaggtcgtcggctcgatgcttggcgcctaccgccggttcagggacacgtcggtg
tttgtaagcatcgccgccggcgtgccgatctcgaccttcgagaataccctgggcaacgcc
gcgatcgtgcgcgccatgcccaatatgccggcctcgatcggcatgggggtgattgcagcc
tttggcagcactcacatcgacgacaatcagacgggttttgtcaccgatcttctggcggcc
gtcggcagtgttcactggctggcggaggaacggcttgtcgatgcggcaacggcgatatcc
ggttccgggccggcctatctcttccatttcatcgagtgtctgaccggcgcgggaattgcc
ggcggcctgccgccggaaaccgctcttgccttggcaaagcagacggtcattggcgccgct
gctcttgccagcaccagcgcattttcgccggcagagctgcgccggcaggtgaccagcccg
aacggcacgaccgccgccgcgcttgatgtcctgacgtctgagccaagtctggccgatctg
gtgaagcgggcggccgcggctgcgcatcgccgggcgttggaactggccctcggcaactga

DBGET integrated database retrieval system