KEGG   Ensifer adhaerens OV14: OV14_b0118Help
Entry
OV14_b0118        CDS       T03054                                 

Gene name
nrtB
Definition
(GenBank) Nitrate transport permease protein NrtB
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
ead  Ensifer adhaerens OV14
Pathway
ead00910  Nitrogen metabolism
ead02010  ABC transporters
Module
ead_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:ead00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    OV14_b0118 (nrtB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    OV14_b0118 (nrtB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ead02000]
    OV14_b0118 (nrtB)
Transporters [BR:ead02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    OV14_b0118 (nrtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Romo1
Motif
Other DBs
NCBI-ProteinID: AHK46736
UniProt: W8I8V1
LinkDB All DBs
Position
pOV14b:complement(130583..131476)
Genome map
AA seq 297 aa AA seqDB search
MSVTNLKLPQEAAQRPVARVIAFTRATKPGGSRRLPAALATALTNLVPLVVTLSFILVAW
QVICSAPDSSLPAPTRVLEESWELIAHPFYVGQGVDQGLFWHISASLQRVAIGYALAAVV
GIALGALVGQSALAMRGLDPIFQVLRTVPPLAWLPLSLAAFQDGTPSAIFVIFITAIWPI
IINTAVGIRNIPQDYQNVAKVLRLNAFEYFAKIMLPAAAPYIFTGLRIGIGLSWLAIVAA
EMLIGGVGIGFFIWDAWNSSLISDIIVALIYVGIVGFLLDRLIALIGRVVTRGTATA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcaccaatctcaagcttccgcaggaggctgctcagcggcccgtggcccgggtc
atcgcctttacccgtgcgacgaagcccggcggcagccgccggttgccggcagcactcgcc
acagccttgaccaacctcgtcccgctggtggtgaccctgagctttatcctcgtcgcctgg
caggtgatctgttctgcgcccgactcgagcctgccggcgccgacacgtgttctggaggaa
agctgggagctgatcgcgcatccgttctatgtcggacagggcgtcgatcaaggcctgttc
tggcatatttcggccagccttcagcgcgttgcgatcggttatgcgctcgccgctgtcgtc
ggtatcgcgctcggcgcactcgtcggccagagcgcccttgccatgcgcgggctcgatccg
atcttccaggtgctgcgcaccgtgccgccgctcgcctggctgccgctgtcgctcgccgcc
ttccaggacggcaccccctcggcgatcttcgtgatcttcatcaccgcgatctggccgatc
atcatcaacaccgccgtcggcatccgcaacattccgcaggactaccagaacgtcgccaag
gtgctgcggctcaatgccttcgagtatttcgccaagatcatgctgccggccgccgcccct
tacatcttcaccggccttcgcatcggcatcggcttgtcctggcttgcgatcgttgccgcc
gagatgctgatcggcggcgtcggcatcggtttcttcatctgggatgcgtggaactcgtcg
ctgatcagcgacatcatcgttgcgctcatctacgtcggcatcgtcggcttcctcctcgat
cgtctcatcgccctcatcggtcgcgtcgtcacccgcggcacggcaactgcgtga

DBGET integrated database retrieval system