KEGG   Ensifer adhaerens OV14: OV14_b0206Help
Entry
OV14_b0206        CDS       T03054                                 

Gene name
rbcL1
Definition
(GenBank) ribulose bisphosphate carboxylase large chain 1
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
ead  Ensifer adhaerens OV14
Pathway
ead00630  Glyoxylate and dicarboxylate metabolism
ead01100  Metabolic pathways
ead01120  Microbial metabolism in diverse environments
ead01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ead00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    OV14_b0206 (rbcL1)
Enzymes [BR:ead01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     OV14_b0206 (rbcL1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AHK46803
UniProt: W8IPQ5
LinkDB All DBs
Position
pOV14b:complement(219287..220495)
Genome map
AA seq 402 aa AA seqDB search
MASKIASDQSTGTFVALPGETEELKARVAARVVAVRPLPPTHQASFSDEAGGAKQFNRAD
VDIDFPMDAVGTDLSALMTIAIGGVFSIKGLTGIRIVDMKLPREFAAAHLGPQFGVAGSF
ALTGVKHRPIIGTIVKPALGLRPHETADMVGELIEAGVDFIKDDEKLMSPAYSPLKDRVA
AIMPKILAHEQKTGKKVMYAFGISHADPDEMMRNHDMVLEAGGNCAVVNINSIGFGGLAF
LRKRSSLVLHAHRNGWDILTRHAGLGFEFSVWQQFWRLLGIDQFQINGIRVKYWEPDESF
VQSYKAISTPLFSEDDRAVPVVCSGQWGGQAPDTIAATGGSTALLYLCGGGIVSHPGGPG
AGVKAVKQAWEAAVAGVPLDAYAQDHPELAQSIEKFADGKAA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgaagatcgccagcgaccagtcgacaggcaccttcgtggcgttgccgggggag
acggaagagctgaaggcgcgcgtggcggcgcgcgtcgtcgccgtccgtccgctgccgccc
acgcaccaggcctccttctctgacgaagcgggtggcgccaaacagttcaaccgtgcggat
gtcgacatcgacttcccgatggacgcggtgggcacggatctctccgcgctgatgaccatc
gccatcggcggcgtgttttccatcaaagggctcacaggtatccgtatcgtcgatatgaag
ctgccgcgggaatttgcggcggcccatctcgggccgcagttcggcgtggcgggaagcttc
gcgttgaccggtgtgaagcatcgcccgatcatcggcaccatcgtcaagccggcgctcggc
ctcaggccgcatgaaacagctgatatggtcggcgagttgatcgaggcgggcgtcgatttc
atcaaggacgacgagaagctgatgagcccggcctattcgccgctgaaggatcgtgtcgcg
gcgatcatgccgaaaatcctcgcccacgagcagaagaccggcaagaaggtcatgtacgcc
ttcggcatcagtcacgccgaccccgacgagatgatgcgcaaccacgatatggtccttgag
gccggcggcaattgcgccgtggtcaacatcaattcgatcggttttggtggtctcgccttc
ctgcgcaagcgctctagcctcgtgctgcatgcccaccgcaatggttgggatatcctcacg
cgccatgccggcctcggcttcgagttttccgtctggcagcagttctggcgcctgctcggc
atcgaccaattccagatcaacggcatccgcgtgaaatactgggagccggacgaaagtttc
gtacaatcctacaaggccatcagcacgccgttgttttcggaagacgacagggcggtgccg
gtggtctgctcgggccagtggggcgggcaggcgcccgatacgatcgcggcgaccggcgga
tcgacagcgcttctctacctctgcggcggcggcatcgtcagccatccgggcgggccggga
gcgggcgtgaaggcggtcaagcaggcatgggaggcggcggtcgcgggcgtgccgctggac
gcttacgcgcaggatcatccggaactcgcgcaatccatcgagaaatttgccgatggcaag
gcggcctga

DBGET integrated database retrieval system