KEGG   Ensifer adhaerens OV14: OV14_b0410Help
Entry
OV14_b0410        CDS       T03054                                 

Definition
(GenBank) putative ATP-dependent DNA ligase protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ead  Ensifer adhaerens OV14
Pathway
ead03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ead00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    OV14_b0410
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ead03400]
    OV14_b0410
Enzymes [BR:ead01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     OV14_b0410
DNA repair and recombination proteins [BR:ead03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     OV14_b0410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: AHK46952
UniProt: W8I8X7
LinkDB All DBs
Position
pOV14b:complement(442464..445118)
Genome map
AA seq 884 aa AA seqDB search
MASDKLSTYKQKRDFKVTKEPSGAGKLSPSNRRRFVIQKHDATQLHYDLRLELDGVFKSW
AVTKGPSLDPQDKRLAVEVEDHPLDYGDFEGTIPKGQYGGGTVMLWDRGYWEPEGNRTPE
EALAKGDFKFTLEGKRLHGSFVLVRMRHDRDGGKRTNWLLIKHRDDFSVDENGAAVLEEN
DTSVASGRSMDAIASGKGRKPKPFMLEGGAIGADAVWDSNHGLAAEERQAGAGSRKKSVS
ARRPKSRMPDFIPPQLCETLDRPPNGGGWIHEIKFDGYRIQMRVENGKATLKTRKGLDWA
AKFAAIAKSAAALPDAIIDGEICALDEKGAPDFAALQAALSEGETDALVYFAFDLLFTGD
EDLRELALTERKERLAAMLEDAGDDPHLRFAEHFETDGDAVLRSARRLSLEGIVSKKADA
PYQSGRSDTWAKSKCRAGHEVVIGAYAKTNGKFRSLLVGVNRGEHFVYVGRVGTGYGAKT
VETLLPKLQKREVSRSPFTGIGAPKKDRNIVWLKPDLVAEIEFAGWTTDGQVRQAAFKGL
REDKPAGEVKAEKPASPSKAAVSDPSTVKPVPNRIRKGGKAEVMGVLISSPEKPLWPDGG
DGKPVTKVELAQYYEAVGSWLIDHIKGRPCSIIRTPDGIGGEQFFQRHAMPGTSNLLELV
TVFGDKKPYLQIDRVEGLAAIAQIGGVELHPWNCEPGKPEVPGRLVFDLDPGPEVEFSTV
IDAAREIRDRLAELGLVSFCKTTGGKGLHVVTPLAVSRRKKLSWEEAKAFAHDICQRMAR
DNPDLYLIRMAKNQREGRIFLDYLRNDRMSTAVAPLSPRARPGATVSMPLNWTQVKKGLD
PTRFTIRTVPELLRAGTAWQDYCESQRSLEQAIKRLSKTNRAAA
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgacaagctctcgacctacaaacagaagcgcgatttcaaagtcaccaaggaa
ccaagcggagcgggcaagctcagcccttccaatcgacgtcgcttcgtcattcaaaaacat
gacgccacccagctgcactacgatcttcgtttggagctcgacggtgtcttcaaatcctgg
gccgtgaccaaggggccatcgctcgatccccaagacaagcgccttgcggtggaggtcgag
gatcacccgctcgactatggcgacttcgaaggcaccattccgaaaggccagtatggcggg
ggcactgtcatgctgtgggatcgcggttattgggagccggaaggaaatcggacgccggaa
gaggcgctggccaaaggtgatttcaagttcacacttgagggcaaacggctccacggcagc
ttcgtgctcgtgcgcatgcgtcatgatcgcgatggtggaaaacgaacgaattggctcctg
atcaaacatcgtgacgatttttcggtcgatgagaacggagcggctgtccttgaggaaaac
gacacctcagtcgcctccggacgctcgatggacgcgatcgcgtcgggcaaaggcagaaag
ccaaagcccttcatgctggagggcggcgccattggggccgacgcggtgtgggacagcaac
cacggtcttgccgccgaggaacgccaggcgggagcggggagccgaaaaaagtctgtgtcc
gccagacgcccgaaatccagaatgcctgatttcatcccaccgcagttatgcgaaacactg
gaccgccctccgaacggcggtggctggatccatgagatcaaatttgatggctatcgcatt
cagatgcgggtcgagaatgggaaggcgactttgaaaacccgcaaaggtctcgactgggca
gccaaatttgccgccatcgccaagtcggcagcagctctgcctgatgccatcatcgatggt
gagatctgtgctcttgacgaaaaaggagcacccgattttgccgcccttcaggcagcactt
tccgaaggcgagactgatgccttggtctactttgcattcgatctcctgtttaccggcgat
gaggacctgcgagagcttgcgctgacagagcggaaagaacggctcgcagcgatgctggag
gatgcgggcgacgatccgcatctgcgcttcgccgagcattttgaaaccgacggtgacgcc
gtgctgcgatcggcccgccgtctttcgcttgagggcatcgtttccaagaaagcggatgcg
ccgtaccagtccggccgctccgacacgtgggcgaaatccaaatgccgcgcaggtcatgaa
gtcgtcatcggcgcctatgcaaagaccaacggcaaattccgatctctccttgttggcgtc
aatcgtggcgagcatttcgtctatgtcggccgggtcgggacaggctatggcgcaaagacc
gtcgaaacgctgttgccgaagctgcaaaagcgcgaggtctccaggtcaccctttacgggg
atcggggcgccaaagaaggatcggaacatcgtttggctcaagccggatctcgttgccgag
atcgagttcgccggctggacgactgatggccaggtgcggcaggcggcattcaagggcttg
agggaagacaaaccggcgggcgaggtgaaagcggaaaaaccggcgtcaccttcaaaggct
gccgtgtccgatccatcgacagtaaagccagtaccaaatcgtatccgcaagggcgggaag
gccgaggtcatgggcgtgctgatttccagcccggaaaaacctctatggccggatggtggc
gatgggaagccggtgaccaaggttgagcttgcccaatattatgaggcggtcgggtcctgg
ctgatcgatcatatcaaagggcggccctgttcgatcattcgcactcccgacgggattggc
ggcgagcaattcttccagcgacatgccatgccgggaacatcgaacctgctcgagctggtc
accgtattcggggacaagaagccctacctgcagatcgaccgcgtcgaggggcttgcggcg
atcgcccagatcggtggtgtcgaactgcatccctggaattgcgagcccgggaaaccggag
gtgcccggccgcctggtgttcgatctggacccgggccccgaagtcgagttttccaccgtc
attgacgcggctcgggaaattcgcgaccggttggcagaactcgggctggtaagcttctgc
aagacgacgggtggcaaggggctgcacgtcgtaacgccgcttgccgtgtcgcgacggaag
aaattgagttgggaagaggcgaaggcttttgcccatgatatctgtcagcggatggcccgc
gacaatccggatctttacctgatcaggatggcgaagaaccagcgcgagggccgcatcttc
ctcgactacttgcgcaacgacaggatgtcgaccgctgttgcgcccctgtcgccgcgggcg
cgccccggcgccacggtgtcgatgccgctcaactggacgcaggtcaaaaagggtctcgat
cccacacgcttcaccatccggaccgtgccggagcttctgagagcggggaccgcttggcag
gattattgtgaaagccagcgctcgctggagcaggcgatcaagcgcctgagcaaaacgaac
agggctgcggcgtag

DBGET integrated database retrieval system