KEGG   Ensifer adhaerens OV14: OV14_b0490
Entry
OV14_b0490        CDS       T03054                                 

Definition
(GenBank) arylamine N-acetyltransferase
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
ead  Ensifer adhaerens OV14
Pathway
ead00633  Nitrotoluene degradation
ead01100  Metabolic pathways
ead01110  Biosynthesis of secondary metabolites
ead01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ead00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    OV14_b0490
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    OV14_b0490
Enzymes [BR:ead01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     OV14_b0490
SSDB
Motif
Pfam: Acetyltransf_2
Other DBs
NCBI-ProteinID: AHK47003
UniProt: W8IQD3
LinkDB
Position
pOV14b:528506..529333
AA seq 275 aa
MLRSAVPVDLDQYFARIGYGGPRSPDLANLRAIIAHHVATIPFEAIDVLLGHGIDLSPAT
VDVKLIARRRGGYCFEHNGLFQRVLLSLGYVAEPLIARVLWMRERTAPPPAWSHMALRVV
IDGVAYLVDVGFGSCVPTLPLRFDVAAPQPTTHEMFRLTATPEGFLLKVLLAAKWSPVYE
VSTRICADEEYDIANAGASTHPHSHFRQQLLVALTTPEARNVLLGNRLTIRHRNGQVDRR
WLDPVATEEALINLFGLPFQNEWRRILPQVTSTPA
NT seq 828 nt   +upstreamnt  +downstreamnt
atgctgaggtctgctgttcccgtcgatctcgaccaatacttcgcgcgcattggctacggc
gggccgcgttcaccggatctggcgaaccttcgggcgattatcgcgcaccatgtcgcaacg
attccgttcgaagccatcgacgtccttctgggacacgggatcgatctgtcgcccgcaacc
gtcgatgtcaaactgatcgcgcgccggcgcggcggatactgcttcgagcacaacggactg
tttcaaagggtcctgttatcgctcggctacgtggcagagccgctgattgcccgcgtcctt
tggatgcgggaaagaaccgctccgccgccggcctggtcgcatatggcgctccgcgtcgtt
attgatggagtagcctatcttgtcgacgtcggcttcggcagctgcgttccaacacttccc
ttgcgctttgacgtcgcggcgccacaaccgacgacgcatgagatgtttcgtttgaccgct
acaccggaaggctttttgctcaaggtcctgctcgccgcaaagtggtcaccggtctacgag
gtttcgacgagaatctgcgccgacgaggaatacgatatcgcaaacgccggcgcctcgacc
catccacactcccatttccgccagcaactgcttgtggccttgacgacgccggaagcacga
aacgtactgctcgggaacaggctgacgatccgccatcgtaatggacaggtcgatcgtcgt
tggctggatccagtggcaaccgaggaggcgctaattaatctgttcgggctgccgttccaa
aacgaatggcggcgaatcttgccccaggtaacgagcacacccgcatga

DBGET integrated database retrieval system