KEGG   Klebsiella aerogenes KCTC 2190: EAE_04980Help
Entry
EAE_04980         CDS       T01529                                 

Definition
(RefSeq) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
eae  Klebsiella aerogenes KCTC 2190
Brite
KEGG Orthology (KO) [BR:eae00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:eae03012]
    EAE_04980
   03029 Mitochondrial biogenesis [BR:eae03029]
    EAE_04980
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eae04147]
    EAE_04980
Translation factors [BR:eae03012]
 Eukaryotic Type
  Elongation factors
   EAE_04980
 Prokaryotic Type
   EAE_04980
Mitochondrial biogenesis [BR:eae03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    EAE_04980
Exosome [BR:eae04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   EAE_04980
  Exosomal proteins of breast cancer cells
   EAE_04980
  Exosomal proteins of colorectal cancer cells
   EAE_04980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-GeneID: 10791169
NCBI-ProteinID: YP_004591202
UniProt: A0A0H3FSZ8
LinkDB All DBs
Position
complement(1023946..1025130)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GDAEWEAKIIELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETAKTTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtacaaaaccgcacgtcaacgttggtactatcggccac
gttgaccatggtaaaactactctgaccgctgcaatcaccaccgtactggctaaaacctac
ggcggtgctgctcgcgcattcgaccagatcgataacgcgccggaagaaaaagctcgtggt
atcaccatcaacacttcccacgttgaatatgacaccccgactcgccactacgcacacgta
gactgcccgggccacgccgactatgttaaaaacatgatcaccggtgctgctcagatggat
ggcgcgatcctggttgttgctgcgactgacggcccgatgccgcagactcgtgagcacatc
ctgctgggtcgtcaggtaggcgttccgtacatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggaactggttgagatggaagttcgtgaactgctgtctcag
tacgatttcccgggcgacgacactccgatcgttcgtggttctgctctgaaagcgctggaa
ggcgacgcagagtgggaagcgaaaatcatcgaactggctggcttcctggattcttacatc
ccagaaccagagcgtgcgattgacaagccgttcctgctgccgatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgtagagcgcggtatcatcaaagttggt
gaagaagttgaaatcgttggtatcaaagaaaccgcgaaaaccacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgctggtgagaacgtaggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggctaagccgggcagcatcaag
ccgcacaccaagttcgaatctgaagtgtacatcctgtccaaagacgaaggcggccgtcat
actccgttcttcaaaggctaccgtccgcagttctacttccgtactactgacgtgactggt
accatcgaactgccggaaggcgtagagatggtaatgccgggcgacaacatcaaaatggtt
gttaccctgatccacccgatcgcgatggacgatggtctgcgtttcgcaatccgtgaaggc
ggccgtaccgttggcgcgggcgttgtagctaaagttctgggctaa

DBGET integrated database retrieval system