KEGG   Klebsiella aerogenes KCTC 2190: EAE_05370Help
Entry
EAE_05370         CDS       T01529                                 

Gene name
glpD
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00564  Glycerophospholipid metabolism
eae01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eae00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EAE_05370 (glpD)
Enzymes [BR:eae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     EAE_05370 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 NAD_binding_8 FAD_binding_2 3HCDH_N Lycopene_cycl GIDA
Motif
Other DBs
NCBI-GeneID: 10791247
NCBI-ProteinID: YP_004591280
UniProt: A0A0H3FND3
LinkDB All DBs
Position
1105575..1107083
Genome map
AA seq 502 aa AA seqDB search
MEIKDLIVIGGGINGAGIAADAAGRGLSVLMLEARDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHLAFPMRFRLPHRPHLRPAWMIRIGLFLYDHLGKRTSLPGS
TGLRFGAESVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVRTRTRAISAKRENG
LWVVEAEDIDSGEKFTWHARGLVNATGPWVKHFFDEGMHLRSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYNGDPKEVAIDDKEINYLLNVYNAHF
KKTLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGQAPLLSVFGGKLTTYRK
LAEHALEKLTPYYQGIGPAWTKTAVLPGGDIGGDRDDYAAKLRRRFAFISESMARHYART
YGSNSEWILGEATSLADLGEDFGHEFYEAELKYLVEHEWVRSLDDAIWRRTKQGMWLNAE
QQTRISEWLAQHTGKSELSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaatcaaagatctgattgtgataggcggaggcatcaacggtgccggtatcgcggca
gacgccgccgggcgcggtttatccgtgctgatgctggaagcgagagaccttgcctgcgcc
acctcgagcgccagctcaaaactgattcacggcggcctgcgctacctggaacactacgaa
ttccgcctggtcagcgaagcgctggcggagcgcgaggtgttattaaaaatggcgccgcat
ttggccttcccgatgcgctttcgcttaccacatcgcccgcatctgcgcccggcgtggatg
attcgtatcggtctgtttttatacgatcacctcggcaaacgtaccagcctgccgggctcg
accggtttgcgctttggcgcggaatcggtacttaagccggaaatcgtgcgcggtttcgaa
tattccgactgctgggtcgacgatgcgcgtctggttcttgccaacgcccagatggtggta
cgtaaaggcggcgaggttcgcacccgcacccgcgctatctcggcaaaacgcgaaaacggc
ctgtgggtggtggaagcggaagatatcgatagcggcgaaaaattcacctggcacgcgcgc
ggcctggttaacgccaccggcccgtgggtgaaacatttcttcgacgaaggcatgcatctg
cgctcgccgtatggcatccgtctgatcaaaggcagccatatcgtggtgccgcgcgtgcac
acccagaagcaggcctatatcctgcaaaacgaagataaacgtatcgtgtttgtcatcccg
tggatggatgagttctcaattatcggcaccaccgacgtcgagtacaacggcgatccaaaa
gaggtggcgatcgatgataaagagatcaactacctgctgaacgtctacaacgcgcacttt
aaaaagacgctgtcgcgcgacgatatcgtctggacttactccggcgtgcgtccgctgtgc
gacgatgaatccgactcgccgcaggcgattacccgcgactataccctcgatattcacgat
gagaacggtcaggcgccgctgctgtcggtattcggcggcaagctcaccacctaccgtaaa
ctggcggaacatgcgctggaaaaactgacgccgtattatcaggggattggcccggcgtgg
accaaaaccgccgttctgcccggcggcgatatcggcggcgaccgcgacgactacgcggcg
aaactgcgccgtcgcttcgcgtttatcagcgaatcaatggcccgccactacgcccgcacc
tacggtagcaacagcgagtggatccttggcgaagcgacttcgcttgccgatctgggagaa
gattttggccacgagttttatgaagccgagctgaagtacctggtcgaacacgagtgggtt
cgcagcctggatgacgctatctggcgccgtaccaaacaggggatgtggctgaatgccgag
cagcagacgcgtatcagcgagtggctggcgcaacatacgggaaagtctgaactgtcgtta
gcgtcctga

DBGET integrated database retrieval system