KEGG   Klebsiella aerogenes KCTC 2190: EAE_07515Help
Entry
EAE_07515         CDS       T01529                                 

Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
eae  Klebsiella aerogenes KCTC 2190
Brite
Enzymes [BR:eae01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     EAE_07515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Spore_YpjB
Motif
Other DBs
NCBI-GeneID: 10791679
NCBI-ProteinID: YP_004591706
UniProt: A0A0H3FPJ8
LinkDB All DBs
Position
1563598..1564218
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLSAEELITK
LDQLPADKKTVLRNNAGGHANHSLFWKGLKTGTTLQGDLKAAIERDFGSVDNFKAEFEKA
AATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIIGLDVWEHAYYLKFQN
RRPDYIKAFWDVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttatacactgccatccctgccgtacgcttacgatgctctggaaccgcatttcgac
aagcagacgatggagatccatcatactaagcatcaccagacctacgttaacaacgctaac
gcagcgctggaaagcctgccggaattcgctaacctgtccgcggaagagctgatcactaag
cttgatcaactgccggctgacaaaaaaaccgtactgcgtaacaacgcgggcggccacgct
aaccacagcctgttctggaaaggcctgaaaaccggcaccaccctgcagggcgacctgaaa
gccgctatcgagcgtgatttcggttctgtggacaacttcaaagctgaattcgaaaaagcg
gcagctacccgctttggttccggctgggcgtggctggtgctgaaaggcgacaaactggcc
gtcgtttctaccgctaaccaggactccccgctgatgggcgaagccatttccggcgcttca
ggcttcccgattatcggcctggatgtgtgggaacacgcttactacctgaaattccagaac
cgccgtccggactacatcaaagccttctgggacgtggttaactgggacgaagcagcagcg
cgttttgccgccaaaaaataa

DBGET integrated database retrieval system