KEGG   Klebsiella aerogenes KCTC 2190: EAE_12070Help
Entry
EAE_12070         CDS       T01529                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00250  Alanine, aspartate and glutamate metabolism
eae00280  Valine, leucine and isoleucine degradation
eae00410  beta-Alanine metabolism
eae00640  Propanoate metabolism
eae00650  Butanoate metabolism
eae01100  Metabolic pathways
eae01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EAE_12070
   00650 Butanoate metabolism
    EAE_12070
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EAE_12070
   00280 Valine, leucine and isoleucine degradation
    EAE_12070
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EAE_12070
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:eae01007]
    EAE_12070
Enzymes [BR:eae01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     EAE_12070
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     EAE_12070
Amino acid related enzymes [BR:eae01007]
 Aminotransferase (transaminase)
  Class III
   EAE_12070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 10792623
NCBI-ProteinID: YP_004592607
UniProt: A0A0H3FRP3
LinkDB All DBs
Position
complement(2593407..2594690)
Genome map
AA seq 427 aa AA seqDB search
MTSNKALMQRRSDAVPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
EVIAAVEGQLKKLTHTCFQVLAYEPYLQLCEMMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATGRSGTIAFTGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVYRALYPCALHGISD
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAASPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDITTFAKSIAGGFPLAGVTGRAEVMDAIAPGGLGGTYAG
NPIACAAALAVLKVFEQENLLEKANQLGDKLRKGLLNIAETHREIGDVRGLGAMIAIELF
EEGDHSKPNAKLTADIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIAQGLKIIADC
FNEAKQG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaataaagcgttaatgcagcgccgtagcgacgcggtgccgcgcggcgtcgga
caaattcaccctatctttgccgaccgtgcggagaactgccgggtatgggacgttgaaggc
cgtgaatatctcgatttcgccggcggtatcgcggtgctgaacaccggccacctgcaccct
gaggtgatcgccgcggtggaaggccagttgaagaagctgacccacacctgcttccaggtg
ctggcctacgagccctacctgcagctgtgcgaaatgatgaaccagaaagtgcccggcgat
ttcgccaagaaaaccctgctggtgaccaccggttcggaagcggtggaaaacgcggtcaaa
atcgcccgcgcggcgaccgggcgtagcggcaccatcgcctttaccggcgcctatcatggc
cgtacccattacaccctctcgttaaccggtaaagtgaacccttactccgcgggcatgggg
ttaatgccgggccacgtttatcgcgcgctctacccgtgcgcgctgcacggtatcagcgat
gatgacgcgatcgccagcatccatcgcatcttcaaaaatgacgccgcgccggaagatatc
gccgctatcgtcatcgaacccgtccagggcgaaggcggtttctacgccgcctccccggcc
tttatgcagcgcctgcgcgcgctgtgtgacgagcacggcatcatgctgatcgccgatgaa
gtccagagcggcgctggccgtaccggcacgctattcgcgatggagcagatgggcgtggcg
ccggatatcaccacctttgccaaatccatcgccggcggtttcccgctggcgggcgtcacc
ggacgggcggaagtcatggacgccatcgcgccgggcggattgggcggcacctatgccggc
aacccgattgcctgcgccgccgcgctggcggtactcaaggttttcgaacaggaaaacctg
ttggaaaaagccaatcagctcggcgacaagctgcgtaaaggcctgctcaatatcgccgaa
acacatcgcgaaatcggcgacgtccgcggcctgggggcgatgatcgccattgaactcttt
gaagagggcgatcacagcaaacccaacgccaaactgacggcggatatcgtcgcccgcgcg
cgggataaaggcctgatcctgctctcctgcgggccgtactacaacgtgctgcgtattctg
gtgccgctgactatcgaagatgcgcagatcgcgcagggactgaagattatcgccgactgt
tttaacgaagctaaacaaggctaa

DBGET integrated database retrieval system