KEGG   Klebsiella aerogenes KCTC 2190: EAE_13590Help
Entry
EAE_13590         CDS       T01529                                 

Definition
(RefSeq) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00030  Pentose phosphate pathway
eae01100  Metabolic pathways
eae01110  Biosynthesis of secondary metabolites
eae01120  Microbial metabolism in diverse environments
eae01130  Biosynthesis of antibiotics
eae01200  Carbon metabolism
eae01230  Biosynthesis of amino acids
Module
eae_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
eae_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:eae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EAE_13590
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    EAE_13590
Enzymes [BR:eae01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     EAE_13590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N DXP_synthase_N E1_dh TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 10792929
NCBI-ProteinID: YP_004592911
UniProt: A0A0H3FXR0
LinkDB All DBs
Position
2921597..2922427
Genome map
AA seq 276 aa AA seqDB search
MNPYRFDIQTLERKARAVRRHIVRLNANSPAGGHTGADLSQVELLTALYFRVLNAAPDRL
DDPQRDIYIQSKGHAVGCYYCVLAEAGFFPNDWLETYQHANSHLPGHPVRQKTPGIELNT
GALGHGLPVAVGLALAAKKSNSPRRIFLITGDGELAEGSNWEAALAAAHYGLDNLVIIND
KNNLQLAGPTREIMNTDPLADKWRAFGMEVSECDGNDMASVVAAIEGLQQNGKPNVIIAN
TTKGAGISFIQGRPEWHHRVPKGEEIALALEELKDE
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaatccctacagatttgatatccagacgcttgagcgcaaagcgcgcgccgtgcgccgc
cacattgtccgcttaaacgccaatagtccggctggcggtcacaccggggctgacctgtcg
caggtcgaattgttaaccgcgctctatttccgcgtactcaatgcggcgcccgatcgtctt
gacgacccgcagcgcgatatctatatccagtcgaaaggccatgcggtgggctgctactac
tgcgtactggcggaagccggtttcttcccgaacgattggctggagacctaccagcacgcg
aactcgcaccttcccggtcatccggtgcggcagaaaacgccgggcattgagcttaacacc
ggcgcgctgggccacggtttgcctgttgcggtggggctggcgctggccgcaaagaaaagc
aacagcccccgccgcatctttttaatcaccggcgacggcgaactggcagaaggcagtaac
tgggaggcggcgctggcggcggcccattatggcctcgataacctggtcattattaatgat
aagaacaatcttcagctggccgggccaacccgtgaaattatgaataccgatccgctggcc
gataaatggcgcgccttcggcatggaggtcagcgaatgcgacggcaacgatatggcttcg
gtggtcgcggctatcgaagggctgcagcagaacggtaaacctaacgtcattattgccaac
accacgaagggcgcgggcatctcctttatccaggggcgcccggagtggcaccaccgggtg
ccgaaaggcgaggaaatcgcactggcgctggaggaactgaaagatgagtaa

DBGET integrated database retrieval system