KEGG   Klebsiella aerogenes KCTC 2190: EAE_13775Help
Entry
EAE_13775         CDS       T01529                                 

Definition
(RefSeq) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
eae  Klebsiella aerogenes KCTC 2190
Brite
KEGG Orthology (KO) [BR:eae00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EAE_13775
Enzymes [BR:eae01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EAE_13775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored Thi4 NAD_binding_8 K_oxygenase Glutaredoxin FMO-like FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 10792966
NCBI-ProteinID: YP_004592948
UniProt: A0A0H3FSP3
LinkDB All DBs
Position
2962464..2964029
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLAV
RKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRNLDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVFVNGQE
FGQGRMTLTEIVAKVDTGAEKRAAEELNKRDAYDALIVGSGPSGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSEYDVDVIDSQSAAKLIPAAVEG
GLHQIETASGAVLKARSVIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGVVEHVTLLEFAPGMKADQVLQDKVRSLKNVDIILNAQTTEVVGD
GSKVTGLQYRDRVSGDEHHVALAGIFVQIGLLPNTNWLEGTVERNRMGEIIIDAKCETNV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSSFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccaacatgaaaacccagctcaaggcctatcttgagaagctgaccaaacct
gttgagctgattgccacgctggatgacagcgctaaatcggcagagatcaaggaactgttg
gctgaaatcgctgaactgtcagacaaagttacctttaaagaagacaacacgctggcggta
cgtaagccatcgttcctgattactaacccaggttccaaccaggggccgcgttttgctggt
tctcccctgggacatgagttcacctcattagtgctggcgctactgtggaccggcggtcat
ccgtcgaaagaagcgcagtcgctgctggagcagatccgcaaccttgacggtgattttgaa
ttcgagacttactactcgctctcttgccacaactgcccggacgtggtgcaggcgctgaac
ctgatggcggtgctgaacccgcgcatcaaacacacggcgattgatggtggaaccttccag
aatgaaatcaccgatcgcaacgtgatgggcgtaccggcggtgtttgtgaatggtcaggag
tttggtcaaggtcgtatgacgctgactgaaatcgtcgccaaagtggataccggcgcggaa
aaacgcgcggcggaagagctgaacaaacgcgatgcttatgatgctctgatcgtcggttcc
ggcccgtctggtgccgcggcggcggtatactccgcgcgtaaaggcattcgtaccggcctg
atgggcgaacgtttcggcggccaggtgctggataccgtagatatcgaaaactatatttcc
gtaccgaaaaccgaaggccaaaaactggctggcgccctgaaagcgcacgtcagtgaatat
gatgttgatgtgattgattcacaaagcgcggcaaaactgatcccggcagccgtcgaaggc
ggcctgcatcagatcgaaaccgcctccggcgcggtgctgaaagcgcgcagcgtgatcatc
gcaaccggcgccaaatggcgtaacatgaacgtacctggtgaagaccaataccgcactaag
ggcgtaacctactgcccgcactgcgacggcccgctgttcaaaggtaaacgcgtggcggtg
attggcggcggtaactctggcgttgaagcggcaattgatttggcgggcgtcgttgaacac
gtgacgttgctggagttcgcgccaggaatgaaagccgaccaggtgctgcaggataaagta
cgcagcctgaaaaatgtcgatattattctcaacgcccagaccactgaagtggttggcgac
ggtagtaaggtgacggggctacagtaccgcgaccgcgtcagcggcgatgagcatcatgtc
gcgttagccggtatttttgtccagatcggcctgttgccgaataccaactggctggaaggt
acggttgagcgtaaccgcatgggtgaaatcatcattgatgccaaatgtgaaaccaacgtg
aagggcgtgtttgccgccggcgactgcactaccgtgccgtacaaacaaattattatcgcc
actggcgaaggtgcgaaggcttctttgagctcatttgattatctgattcgcaccaaaacc
gcataa

DBGET integrated database retrieval system